BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30224X (533 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50193-6|AAL32262.1| 1175|Caenorhabditis elegans Cytokinesis def... 27 6.4 U50193-5|AAL32263.1| 1178|Caenorhabditis elegans Cytokinesis def... 27 6.4 AF469173-1|AAL79016.1| 1175|Caenorhabditis elegans ubiquitin c-t... 27 6.4 AC006674-6|AAY55871.1| 43|Caenorhabditis elegans Hypothetical ... 27 8.5 >U50193-6|AAL32262.1| 1175|Caenorhabditis elegans Cytokinesis defect protein 3, isoforma protein. Length = 1175 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 121 SPYYEQPDATNYD*KTLFSHSQTRSSGHSICY 26 +P+ ++PD Y+ L +H S GH I Y Sbjct: 1104 APFVDKPDGNTYECIALANHYGQLSCGHFIAY 1135 >U50193-5|AAL32263.1| 1178|Caenorhabditis elegans Cytokinesis defect protein 3, isoformb protein. Length = 1178 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 121 SPYYEQPDATNYD*KTLFSHSQTRSSGHSICY 26 +P+ ++PD Y+ L +H S GH I Y Sbjct: 1107 APFVDKPDGNTYECIALANHYGQLSCGHFIAY 1138 >AF469173-1|AAL79016.1| 1175|Caenorhabditis elegans ubiquitin c-terminal hydrolase protein. Length = 1175 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 121 SPYYEQPDATNYD*KTLFSHSQTRSSGHSICY 26 +P+ ++PD Y+ L +H S GH I Y Sbjct: 1104 APFVDKPDGNTYECIALANHYGQLSCGHFIAY 1135 >AC006674-6|AAY55871.1| 43|Caenorhabditis elegans Hypothetical protein K12H6.10 protein. Length = 43 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 458 IVYF*NISEFYSLFILKYSNSDETL 532 +V+F N F+S+F + Y +S+ET+ Sbjct: 7 LVFFLNCLIFHSIFAMTYESSEETM 31 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,171,406 Number of Sequences: 27780 Number of extensions: 181580 Number of successful extensions: 314 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1060113800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -