BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30223 (502 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0129 - 12590983-12591315,12591432-12591705,12591816-12593800 32 0.23 12_01_0932 + 9253975-9254676,9254976-9255092,9255160-9255192 31 0.52 11_04_0347 + 16628129-16628244,16628343-16628512,16629141-166294... 31 0.69 06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 28 4.8 01_05_0698 + 24376193-24376708 28 4.8 09_04_0619 - 19001350-19001359,19001737-19001800,19001955-190020... 27 8.5 07_01_0149 - 1081805-1081821,1081860-1081941,1082412-1083425 27 8.5 01_06_0012 + 25575196-25575198,25575769-25575945,25576034-255760... 27 8.5 >09_03_0129 - 12590983-12591315,12591432-12591705,12591816-12593800 Length = 863 Score = 32.3 bits (70), Expect = 0.23 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 186 PESCCVKKSILSTFAGNNCTVD 251 P SCCV+K I+S F NCT D Sbjct: 53 PASCCVRKIIVSNFLPLNCTKD 74 >12_01_0932 + 9253975-9254676,9254976-9255092,9255160-9255192 Length = 283 Score = 31.1 bits (67), Expect = 0.52 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 251 RPNPGCGPKI--GELYQKWNKPIAGVALGVACIEVVGALF 364 RP P CGP+ G Q+W + G +E++GALF Sbjct: 120 RPRPRCGPRARSGVAAQQWRHGRTVASEGRQSVELIGALF 159 >11_04_0347 + 16628129-16628244,16628343-16628512,16629141-16629409, 16630337-16630475,16630573-16630639,16630721-16630842, 16630946-16631085 Length = 340 Score = 30.7 bits (66), Expect = 0.69 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 254 PNPGCGPKIGELYQKWNKPIAGVALGVACIEVVG 355 P+ G + ++ W+KPI ++LG CI ++G Sbjct: 231 PSDMLGGHVDDMEADWSKPIVSISLGCKCIFLLG 264 >06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 Length = 1613 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -3 Query: 443 VPVYNVQNISSVTFCPCFLWNWRGTARTGLLPPQYKQLREQRRL 312 + + +++ +SS+ P F+ ++ T + G LPP LR RL Sbjct: 1434 ISISSLEMLSSLVSPPIFITSFSLTGKLGSLPPWVASLRSVSRL 1477 >01_05_0698 + 24376193-24376708 Length = 171 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 308 PIAGVALGVACIEVVGALFALCLANSIRN 394 P+AGV + A + V ALF CLA +R+ Sbjct: 126 PVAGVLVMGADVAGVSALFGFCLAEYLRH 154 >09_04_0619 - 19001350-19001359,19001737-19001800,19001955-19002099, 19002434-19002917,19003175-19003260,19003417-19003484, 19003565-19003709,19004561-19004677 Length = 372 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 230 GEGREDALLDATGLGQRELAVVDSASVT 147 G G+E+ L+ATG+ E+ + D+ +T Sbjct: 34 GAGQEELGLEATGIESNEIKIADTTEMT 61 >07_01_0149 - 1081805-1081821,1081860-1081941,1082412-1083425 Length = 370 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 354 PTTSIQATPRATPAIGLFHFW 292 PTT+ ++P + PAIG H+W Sbjct: 80 PTTTAASSPFSPPAIGSPHWW 100 >01_06_0012 + 25575196-25575198,25575769-25575945,25576034-25576078, 25576164-25576371,25576685-25576875,25577078-25577473 Length = 339 Score = 27.1 bits (57), Expect = 8.5 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 224 LRRQQL-HGRRPNPGCGPKIGELYQKWNKPIAGVALG 331 LR Q+ H R NP C GELY PIA + LG Sbjct: 289 LRPVQISHYRLNNPFCWQAFGELYTPTVPPIACLHLG 325 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,097,946 Number of Sequences: 37544 Number of extensions: 230844 Number of successful extensions: 782 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -