BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30223 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47462| Best HMM Match : Ras (HMM E-Value=0) 34 0.057 SB_26670| Best HMM Match : Tetraspannin (HMM E-Value=1.09301e-43) 34 0.057 SB_41644| Best HMM Match : Tetraspannin (HMM E-Value=0) 30 0.93 SB_46721| Best HMM Match : Tetraspannin (HMM E-Value=4e-35) 29 2.8 SB_28188| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_4913| Best HMM Match : CBF (HMM E-Value=2.9) 28 3.8 SB_32709| Best HMM Match : Spectrin (HMM E-Value=8.8) 28 3.8 SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) 28 5.0 SB_15887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_20279| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_54514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_49793| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_47412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 27 8.7 SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_47462| Best HMM Match : Ras (HMM E-Value=0) Length = 385 Score = 34.3 bits (75), Expect = 0.057 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 311 IAGVALGVACIEVVGALFALCLANSIRN 394 I GVALG+A +++G F+ CLA+++ N Sbjct: 351 IGGVALGLAVFQLIGIAFSCCLASTLHN 378 >SB_26670| Best HMM Match : Tetraspannin (HMM E-Value=1.09301e-43) Length = 211 Score = 34.3 bits (75), Expect = 0.057 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = +3 Query: 30 IKESIMDGVGVLFKKRSDANADEAAEAVFSELQRQFECCGNTGAINY-------GQFTLP 188 +K+ I + K ++ + F LQ + +CCG G +++ G T+P Sbjct: 122 VKDEIESDLTKALKGDYGSSGQDGVTKAFDALQEKQKCCGVNGYLDWKASKKYNGTSTVP 181 Query: 189 ESCCVKKS 212 +SCCV K+ Sbjct: 182 DSCCVVKA 189 >SB_41644| Best HMM Match : Tetraspannin (HMM E-Value=0) Length = 252 Score = 30.3 bits (65), Expect = 0.93 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 3 VLLFTYGESIKESIMDGVGVLFKKRSDANADEAAEAVFSELQRQFECCGN 152 VL + Y E I++++ + + + D A+ E+ R F+CCGN Sbjct: 107 VLAYVYRERIEKNLHGDIRSTMNEYHLSGHDAVTRAI-DEIHRDFKCCGN 155 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 311 IAGVALGVACIEVVGALFALCLANSIRNM 397 I+G + +A I+++G +FA CL IR + Sbjct: 218 ISGFGIWIAVIQLMGIIFATCLCCHIRTI 246 >SB_46721| Best HMM Match : Tetraspannin (HMM E-Value=4e-35) Length = 642 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 105 EAVFSELQRQFECCGNTGAIN---YGQFTL---PESCCVK 206 +A +Q FECCG G + YGQ P SCC K Sbjct: 484 KAAIDAMQMDFECCGAKGPSDWTFYGQMKYKAGPGSCCGK 523 >SB_28188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 158 RYQLRPVHVARVLLRQEEHPLYLRRQQLHGRRPNPGCGPKI 280 RY+ R +H++ VL ++ ++ G+R NPGC P + Sbjct: 14 RYRCRRLHMSDVLFEWDQ------KRYKEGKRLNPGCSPSL 48 >SB_4913| Best HMM Match : CBF (HMM E-Value=2.9) Length = 328 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 45 MDGVGVLFKKRSDANADEAAEAVFSELQR 131 + G+G++FK+R+ N +F ELQR Sbjct: 55 LKGLGLMFKQRTGRNLPMTHPVIFDELQR 83 >SB_32709| Best HMM Match : Spectrin (HMM E-Value=8.8) Length = 230 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 45 MDGVGVLFKKRSDANADEAAEAVFSELQR 131 + G+G++FK+R+ N +F ELQR Sbjct: 55 LKGLGLMFKQRTGRNLPMTHPVIFDELQR 83 >SB_47590| Best HMM Match : TSP_3 (HMM E-Value=7.6e-09) Length = 669 Score = 27.9 bits (59), Expect = 5.0 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = +3 Query: 84 ANADEAAEAVFSELQRQFECCGNT-GAINYGQF---------TLPESCCVKKS 212 +N ++A +AV Q F+CCG T G ++ T+PESCC KK+ Sbjct: 528 SNKEKATKAV-DRAQSIFKCCGATQGPKDWANTAWAKSNTNQTVPESCCKKKA 579 >SB_15887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.5 bits (58), Expect = 6.6 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 13/84 (15%) Frame = +3 Query: 3 VLLFTYGESIKESIMDGVGVLFKKRSDANADEAAEAVFSELQRQFECCGNTGAINYGQ-- 176 V +F + + ++ I++ + K D NAD + + +Q++F+CCG G ++ + Sbjct: 95 VFVFVFQDKVEAVIVEKLQTAVTKYRD-NAD--LQNLIDGVQQEFKCCGAKGINDWDKNI 151 Query: 177 -FT----------LPESCCVKKSI 215 F +P SCC+K +I Sbjct: 152 YFNCSSPGSEACGVPYSCCIKDTI 175 >SB_20279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1100 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 428 VQNISSVTFCPCFLWNWRGTARTGLL 351 ++ I T PCF WN +G LL Sbjct: 829 LREIGPDTLIPCFTWNLKGNTNVNLL 854 >SB_54514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 266 CGPKIGELYQKWNKPIAGVALGVACIEVVGALFA 367 C K+ +L Q+ +KP + +GV C E + A+ A Sbjct: 81 CFIKVVQLVQQASKPQEAIFVGVGCFESMTAVLA 114 >SB_49793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 170 RPVHVARVLLRQEEHPLYLRRQQLH-GRRP 256 RP HVAR HP ++ R+ H RRP Sbjct: 18 RPYHVARRPYHMARHPYHVARRLYHMARRP 47 >SB_47412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 158 RYQLRP-VHVARVLLRQEEHPLYLRRQQLHGRRP 256 R+ RP +H R L + L+ RR +LH RRP Sbjct: 157 RHTRRPRLHTRRPRLHRRRTRLHTRRPRLHTRRP 190 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 182 VARVLLRQEEHPLYLRRQQLHGRRPNPGCGPKIGELYQK 298 V + LL QE+ LY+ +Q+ R+P P ++ +YQ+ Sbjct: 518 VEKELLIQEKEKLYMELKQILARQPGPEVAEQL-SIYQQ 555 >SB_44753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 27.1 bits (57), Expect = 8.7 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +2 Query: 218 LYLRRQQLHGRRPNPGCGPKIGELYQKWNKPIAGVALGVACIEVVGALFALCLANSIRN- 394 LYL + G N G Y+ W V G +C+ V+ A L+N++RN Sbjct: 903 LYLLKAHREGSETNTIAYVVGGSRYETWQHVYTAVTRGRSCVYVIHDPNA--LSNAVRNE 960 Query: 395 -MDRRSRY*YFVHYKLVRLKRR 457 + R++R F+ + + + R Sbjct: 961 PIKRQTRLAEFLKTMIAQNRER 982 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,464,271 Number of Sequences: 59808 Number of extensions: 250445 Number of successful extensions: 716 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -