BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30223 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 3.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.8 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 7.7 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.8 bits (49), Expect = 3.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 380 NSIRNMDRRSRY*YFVHYKLV 442 N++ N DRR Y++H +L+ Sbjct: 222 NNVVNKDRRGELFYYMHQQLI 242 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 5.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 257 NPGCGPKIGELYQKWNKPIAGVAL 328 NPG + GEL + +++P VAL Sbjct: 1577 NPGSVAQRGELSRTFDRPFESVAL 1600 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 9 LFTYGESIKESIMDGV-GVLFKKRSDANADEAAEAVFSELQRQF 137 L ++ +I G+ + FKK+ + A E + S++ +QF Sbjct: 3159 LLLVAPTVVRNIASGLRNLFFKKKPEQQAHEVSTLEHSQIDKQF 3202 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 9 LFTYGESIKESIMDGV-GVLFKKRSDANADEAAEAVFSELQRQF 137 L ++ +I G+ + FKK+ + A E + S++ +QF Sbjct: 3162 LLLVAPTVVRNIASGLRNLFFKKKPEQQAHEVSTLEHSQIDKQF 3205 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 200 RQEEHPLYLRRQQLHGRRPNPGCGPKI 280 +Q+ P YL+ QQL ++ C P + Sbjct: 196 QQQRQPQYLQPQQLQRQQEELTCPPGV 222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 452,635 Number of Sequences: 2352 Number of extensions: 9063 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -