BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30223 (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 42 4e-06 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 0.77 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 3.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 3.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 4.1 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 41.9 bits (94), Expect = 4e-06 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +2 Query: 263 GCGPKIGELYQKWNKPIAGVALGVACIEVVGALFALCLANSIRNMDRR 406 GC + + + VA+ +A +E++G + ALCLANSI+N +RR Sbjct: 181 GCVEALKDTVKLAGTVFGSVAIAIAIVELIGIICALCLANSIKNAERR 228 Score = 28.7 bits (61), Expect = 0.036 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 123 LQRQFECCGNTGAINYGQFTLPESCC 200 +Q+ +CCG +Y +P SCC Sbjct: 139 IQKNLQCCGVHSLSDYNDKPIPASCC 164 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 24.2 bits (50), Expect = 0.77 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 69 KKRSDANADEAAEAVFSELQRQ 134 +KR DA DE+ EA+F + RQ Sbjct: 292 EKRDDAK-DESVEAIFQSILRQ 312 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 33 KESIMDGVGVLFKKRSDANADEAAEAVFSELQR 131 K S+M G+ + + DE VFS LQR Sbjct: 96 KRSLMGAQGLSIRGLQINHEDETIRPVFSTLQR 128 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +2 Query: 296 KWNKPIAGVALGVACIEVVGALFALCL 376 +WN A ++C+ +V + CL Sbjct: 510 RWNSAFAIAPAVISCLGIVATMAVACL 536 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +2 Query: 296 KWNKPIAGVALGVACIEVVGALFALCL 376 +WN A ++C+ +V + CL Sbjct: 600 RWNSAFAIAPAVISCLGIVATMAVACL 626 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 4.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 303 FHFW*SSPILGPQP 262 F FW S ++GP+P Sbjct: 26 FDFWKSRGVVGPKP 39 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,963 Number of Sequences: 438 Number of extensions: 2017 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -