BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30223 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19870.2 68417.m02913 kelch repeat-containing F-box family pr... 29 1.8 At4g19870.1 68417.m02912 kelch repeat-containing F-box family pr... 29 1.8 At3g21880.1 68416.m02759 zinc finger (B-box type) family protein... 29 1.8 At1g55610.1 68414.m06365 protein kinase family protein contains ... 28 3.1 At5g15030.1 68418.m01762 paired amphipathic helix repeat-contain... 27 9.4 At1g69710.1 68414.m08022 zinc finger protein, putative / regulat... 27 9.4 >At4g19870.2 68417.m02913 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 400 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 126 QRQFECCGNTGAINYGQFTLPESCCVKKSILSTFAGN 236 Q ++ECC G+ P S CV +S+L TFA N Sbjct: 260 QGEWECCE-------GEVAFPRSQCVMESVLYTFANN 289 >At4g19870.1 68417.m02912 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 400 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 126 QRQFECCGNTGAINYGQFTLPESCCVKKSILSTFAGN 236 Q ++ECC G+ P S CV +S+L TFA N Sbjct: 260 QGEWECCE-------GEVAFPRSQCVMESVLYTFANN 289 >At3g21880.1 68416.m02759 zinc finger (B-box type) family protein contains similarity to zinc finger protein GB:BAA33206 from [Oryza sativa] Length = 364 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 180 TLPESCCVKKSILSTFAGNNCTVDARIPAAVPRSASSTRNG 302 T+P + K+ S+F G+N TVD + A+ P + G Sbjct: 211 TVPNCLLIDKTNTSSFTGSNFTVDKALEASPPGQQMNINTG 251 >At1g55610.1 68414.m06365 protein kinase family protein contains Prosite:PS00107: Protein kinases ATP-binding region signature Length = 1166 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 180 TLPESCCVKKSILSTFAGNNCTVDARIPAAVPR 278 T+PE CVK L T NN + IP ++ R Sbjct: 465 TIPEGVCVKGGNLETLILNNNLLTGSIPESISR 497 >At5g15030.1 68418.m01762 paired amphipathic helix repeat-containing protein low similarity to transcriptional repressor SIN3B [Mus musculus] GI:2921547; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 271 Score = 26.6 bits (56), Expect = 9.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 203 QEEHPLYLRRQQLHGRRPNPGCG 271 Q +HP+ R +L G+ P PG G Sbjct: 164 QNQHPVGSPRNELQGQSPKPGNG 186 >At1g69710.1 68414.m08022 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1028 Score = 26.6 bits (56), Expect = 9.4 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 9 LFTYGESIKESIMDGVG-VLFKKRSDANADEAAEAVFSELQRQFECCGNTGAI 164 +F +GESI + ++ G G L DA +A E+ L Q CG A+ Sbjct: 249 VFVWGESISDGVLSGTGNSLNSTTEDALLPKALESTI-VLDAQNIACGKCHAV 300 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,304,405 Number of Sequences: 28952 Number of extensions: 169719 Number of successful extensions: 542 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -