BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30221 (828 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 33 0.002 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 8.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 8.0 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 8.0 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 33.5 bits (73), Expect = 0.002 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = -1 Query: 153 KEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN 1 +E +Y +C+ E+ + E + A + G++ ED+ K + C K +++ Sbjct: 33 REMTSKYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMD 83 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 6.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 525 FDGQPINENDTPTSLEM 575 FDG I EN+ P LE+ Sbjct: 178 FDGDFITENNLPLGLEV 194 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 8.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 204 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 64 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 418 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 8.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 204 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 64 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 418 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.8 bits (44), Expect = 8.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 204 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 64 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 44 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,777 Number of Sequences: 438 Number of extensions: 4039 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26460186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -