BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30221 (828 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26840.1 68417.m03864 ubiquitin-like protein (SMT3) identical... 58 9e-09 At5g55160.1 68418.m06877 small ubiquitin-like modifier 2 (SUMO) ... 57 1e-08 At5g55170.1 68418.m06878 small ubiquitin-like modifier 3 (SUMO) ... 48 1e-05 At2g32765.1 68415.m04009 small ubiquitin-like modifier 5 (SUMO) ... 35 0.076 At1g68185.1 68414.m07789 ubiquitin-related similar to ubiquitin-... 34 0.10 At5g48710.1 68418.m06029 ubiquitin-related similar to SP|O13351 ... 34 0.13 At2g29340.2 68415.m03563 short-chain dehydrogenase/reductase (SD... 29 2.8 At2g29340.1 68415.m03564 short-chain dehydrogenase/reductase (SD... 29 2.8 At4g33550.1 68417.m04768 protease inhibitor/seed storage/lipid t... 28 6.6 >At4g26840.1 68417.m03864 ubiquitin-like protein (SMT3) identical to Ubiquitin-like protein SMT3 SP:P55852 from[Arabidopsis thaliana]; identical to cDNA SMT3 protein GI:1707371 Length = 100 Score = 57.6 bits (133), Expect = 9e-09 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 367 DEKKGEN-EHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDRAGLSM 507 D+K G+ HINLKV GQD V F+IK+ T L+KLMNAYCDR + M Sbjct: 8 DKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDM 55 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 513 VRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 620 + F FDG+ + TP L+ME+GD I+ QTGG Sbjct: 58 IAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGG 93 >At5g55160.1 68418.m06877 small ubiquitin-like modifier 2 (SUMO) similar to ubiquitin-like protein SMT3 SP:P55852 from [Arabidopsis thaliana]; identical to cDNA small ubiquitin-like modifier 2 (SUMO) GI:22652843; contains Pfam profile PF00240: Ubiquitin family Length = 103 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 367 DEKKGENEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDR 492 D+K + HINLKV GQD V F+IK+ T L+KLMNAYCDR Sbjct: 8 DKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDR 49 Score = 41.1 bits (92), Expect = 9e-04 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 513 VRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 620 + F FDG+ + TP LEME+GD I+ QTGG Sbjct: 57 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 92 >At5g55170.1 68418.m06878 small ubiquitin-like modifier 3 (SUMO) similar to SP|O13351 Ubiquitin-like protein smt3/pmt3 {Schizosaccharomyces pombe}; identical to cDNA small ubiquitin-like modifier 3 (SUMO) GI:22652845 Length = 111 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = +1 Query: 382 ENEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDRAGLSM 507 + H+ LKV QD V FK KK PL+KLM YCDR GL + Sbjct: 14 QEAHVILKVKSQDGDEVLFKNKKSAPLKKLMYVYCDRRGLKL 55 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 519 FRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGV 623 F F+G I +TP L+ME+GD I+ + +GG+ Sbjct: 60 FIFNGARIGGLETPDELDMEDGDVIDACRAMSGGL 94 >At2g32765.1 68415.m04009 small ubiquitin-like modifier 5 (SUMO) similar to ubiquitin-like protein SMT3 SP:P55852 [Arabidopsis thaliana]; contains INTERPRO:IPR000626 ubiquitin domain; contains Pfam profile PF00240: Ubiquitin family; contains Pfam profile PF00240: Ubiquitin family; identical to cDNA small ubiquitin-like modifier 5 (SUMO) mRNA GI:22652847 Length = 108 Score = 34.7 bits (76), Expect = 0.076 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +1 Query: 349 INLKMADEKKGENEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDRAGL 501 ++ K + + + LKV Q A +KI H L+KLM+AYC + L Sbjct: 13 VSKKSRSPETSPHMKVTLKVKNQQGAEDLYKIGTHAHLKKLMSAYCTKRNL 63 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 513 VRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 620 VRF ++G+ I TP L MEE D I + + GG Sbjct: 68 VRFVYNGREIKARQTPAQLHMEEEDEICMVMELGGG 103 >At1g68185.1 68414.m07789 ubiquitin-related similar to ubiquitin-like protein smt3/pmt3 SP:O13351 from [Fission yeast] Length = 215 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 519 FRFDGQPINENDTPTSLEMEEGDTIEVYQQQT 614 F FDG I+ + TP+ L ME+ D IEV+ ++T Sbjct: 184 FIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215 >At5g48710.1 68418.m06029 ubiquitin-related similar to SP|O13351 Ubiquitin-like protein smt3/pmt3 {Schizosaccharomyces pombe} Length = 114 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 516 RFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 620 RF FDG I E TP LE ++GD I+ Q G Sbjct: 70 RFLFDGSRIREYHTPDELERKDGDEIDAMLCQQSG 104 >At2g29340.2 68415.m03563 short-chain dehydrogenase/reductase (SDR) family protein similar to tropinone reductase-I GI:424160 from [Datura stramonium] Length = 262 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 168 LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVL 31 L + K A ++ + ++ + V+ VIN + Y ED +FKK +L Sbjct: 166 LIQLAKNLACEWAKDGIRANAVAPNVINTPLSQSYLEDVSFKKALL 211 >At2g29340.1 68415.m03564 short-chain dehydrogenase/reductase (SDR) family protein similar to tropinone reductase-I GI:424160 from [Datura stramonium] Length = 307 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 168 LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVL 31 L + K A ++ + ++ + V+ VIN + Y ED +FKK +L Sbjct: 166 LIQLAKNLACEWAKDGIRANAVAPNVINTPLSQSYLEDVSFKKALL 211 >At4g33550.1 68417.m04768 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 115 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 219 LICLAFAVFNCGADNVHLTETQ 154 L+ LA A+F G+DNVH+ + Q Sbjct: 9 LVILAIALFMIGSDNVHVAKAQ 30 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,468,659 Number of Sequences: 28952 Number of extensions: 315456 Number of successful extensions: 745 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -