BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30218 (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0065 + 18766566-18766576,18767023-18767083,18767170-187672... 29 2.6 12_02_0526 - 20032206-20033106,20034853-20035181 29 4.5 08_02_1416 - 26915306-26915459,26915553-26915668,26915798-269159... 29 4.5 08_02_1447 - 27162037-27162627,27162790-27162920,27163277-271634... 28 5.9 04_04_1376 + 33058306-33059763,33059851-33059991,33060594-330606... 28 5.9 11_04_0321 - 16359390-16359539,16359674-16359746,16360448-163608... 28 7.8 >11_05_0065 + 18766566-18766576,18767023-18767083,18767170-18767268, 18767346-18767467,18767577-18767673,18767778-18767824, 18768020-18768203,18768349-18768400,18768795-18768985, 18769072-18770020,18770866-18771022,18771134-18771206, 18771292-18771465,18771880-18771993,18772110-18772236, 18772331-18772443,18772614-18772729,18772847-18773000 Length = 946 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -3 Query: 478 LFTRITTCLCEIIWTYLNINNLMQISKRKAFEKINVVCPAEFIL 347 L+ R+ +C N+NNL + + F + + C AE +L Sbjct: 414 LYYRVLEAICRAESQNNNVNNLTPLLSNERFHRCLIACSAELVL 457 >12_02_0526 - 20032206-20033106,20034853-20035181 Length = 409 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 192 SSSHDCNVLVNNRISESCFSSILNSSENV 106 S+S+ N NN IS SC S++NSS N+ Sbjct: 329 SNSNKNNSDNNNNISSSCCISLMNSSSNM 357 >08_02_1416 - 26915306-26915459,26915553-26915668,26915798-26915910, 26915995-26916130,26916219-26916338,26916472-26916648, 26916790-26916862,26916948-26917083,26917179-26918055, 26918138-26918331,26918438-26918620,26918730-26918796, 26918900-26919092,26919317-26919363,26919478-26919574, 26919663-26919790,26919905-26920009,26920763-26920879 Length = 1010 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -3 Query: 478 LFTRITTCLCEIIWTYLNINNLMQISKRKAFEKINVVCPAEFIL 347 L+ R+ +C L+ NNL + + F + + C AE +L Sbjct: 507 LYYRVLESMCRAETQILSGNNLTSLLSNERFHRCMIACSAELVL 550 >08_02_1447 - 27162037-27162627,27162790-27162920,27163277-27163474, 27164038-27164065 Length = 315 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 177 CNVLVNNRISESCFSSILNSSENVTSITNLNIPYC 73 CN + SE C++S +S+ + +TN +PYC Sbjct: 190 CNA--TKKHSERCYASQGSSTNGLKRVTNPELPYC 222 >04_04_1376 + 33058306-33059763,33059851-33059991,33060594-33060644, 33061094-33061171,33061245-33061388,33061871-33062002 Length = 667 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 150 SESCFSSILNSSENVTSITNLNIPYCCDLKTQVDESM 40 ++S F +I +SS N + TNL P C + + +DE + Sbjct: 243 NDSIFHNIASSSHNPSPSTNLPSPNCLLVPSTLDEQL 279 >11_04_0321 - 16359390-16359539,16359674-16359746,16360448-16360845, 16360919-16362673,16362751-16362861,16363745-16363962, 16364088-16364196 Length = 937 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 186 SHDCNVLVNNRISESCFSSILNSSENVTSITNLNIPYCCDLKTQVDE 46 SH C++ ++NR SE+ S N N T + N CC + T ++ Sbjct: 482 SHGCSMTLHNRNSEANHFSEQNIGRNRTEVQN----DCCSIPTSPND 524 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,975,477 Number of Sequences: 37544 Number of extensions: 239314 Number of successful extensions: 472 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -