BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30218 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63060.1 68418.m07912 SEC14 cytosolic factor, putative 29 3.7 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 29 3.7 >At5g63060.1 68418.m07912 SEC14 cytosolic factor, putative Length = 268 Score = 28.7 bits (61), Expect = 3.7 Identities = 26/95 (27%), Positives = 44/95 (46%) Frame = +2 Query: 92 FVMDVTFSELFRMDEKQLSLILLFTRTLQSCELDFLLFLMTNLFYFMFKQL*NPLFI*LP 271 F+++ S+L K L + L Q+ +L FL FL +Y+ +L LF+ P Sbjct: 164 FLLEKALSKLPAGQHKILGIFDLRGFGSQNADLKFLTFLFDVFYYYYPSRLDEVLFVDAP 223 Query: 272 TLRMSR*PV*TKPFSKTYVYEYHRVKNKFCRADYI 376 + P+ F+K V +Y + KFC A+ + Sbjct: 224 FIFQ---PI--WQFTKPLVKQYASLV-KFCSAETV 252 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -3 Query: 478 LFTRITTCLCEIIWTYLNINNLMQISKRKAFEKINVVCPAEFIL 347 L+ R+ +C+ L+ NNL + + F + + C AE +L Sbjct: 495 LYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVL 538 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,352,997 Number of Sequences: 28952 Number of extensions: 223756 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -