BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30217 (823 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G8.06c |trm12||tRNA methyltransferase Trm12 |Schizosaccharo... 30 0.35 SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyce... 28 1.8 SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch... 27 2.4 SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces po... 27 3.2 SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe... 27 4.3 SPAC14C4.03 |mek1||Cds1/Rad53/Chk2 family protein kinase Mek1 |S... 26 5.6 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 26 7.4 SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosacch... 26 7.4 SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|c... 26 7.4 SPBC27.06c |mgr2||mitochondrial membrane protein Mgr1 |Schizosac... 25 9.8 SPAC10F6.17c ||SPAC56E4.01c|mitochondrial pyruvate dehydrogenase... 25 9.8 SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 25 9.8 SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 25 9.8 >SPAC4G8.06c |trm12||tRNA methyltransferase Trm12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 30.3 bits (65), Expect = 0.35 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +3 Query: 171 PSRQRDWSTSSDRRPRHKNGQSKLHQSQSENEQENYNCVLNC*RCFREVLS 323 PS ++ WST++ R + +H++ + + E Y+ +N CF ++L+ Sbjct: 343 PSSEKSWSTATSILKRESHSFIHVHENVKDEDIETYSSEVN--SCFSKMLA 391 >SPBC342.03 |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 456 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 120 RSSAERCGTTTGSPCWSPSRQRDWSTSSDRRPRHKNGQSKLHQSQS 257 + + E G + WSP D S+ RRP+ KN S + + S Sbjct: 376 KGAGEPLGIEGPTNMWSPFHDGDDDESTSRRPKPKNKPSNVTSTTS 421 >SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 681 Score = 27.5 bits (58), Expect = 2.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 65 DEVAKLWGKMKQNDNMTFEKFSRAMRYHYRQSVLVSVPTARLVY 196 D+V K+W + K N + EKF + ++Q L SV R VY Sbjct: 115 DQVLKVWLESKTNPCLDMEKFFQLCE-KFKQLGLSSVLKERFVY 157 >SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 282 SYSFLVHFLIDFDEVWIVRFYVGAFGPNW*TSLAVGTETSTD 157 S S+ V +D W+ + V AF P + + GT+ STD Sbjct: 77 SISYTVAIDLDMPYTWLTYYNVMAFNPAYLGIVNSGTQWSTD 118 >SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 26.6 bits (56), Expect = 4.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 114 PSRSSAERCGTTTGSPCWSPSRQRDW 191 P S A G G P W SRQR W Sbjct: 464 PPNSRARLLGFLNGRPEWCISRQRAW 489 >SPAC14C4.03 |mek1||Cds1/Rad53/Chk2 family protein kinase Mek1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 223 KTDNPNFIKVNQKMNKKT 276 K D+PN IKVN + N +T Sbjct: 212 KLDHPNIIKVNMEYNSET 229 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 25.8 bits (54), Expect = 7.4 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -1 Query: 565 YAALYRVPLFEYSGT---SSDNSRNLNWRVTVFEDSNRNWCINKREYQ 431 YA+L P F ++ NS +L W + +DSN+N +R+ Q Sbjct: 125 YASLNTTPHFPQVSNHAPNNSNSPSLTWHTSSGDDSNQNPFFVRRQSQ 172 >SPAC29B12.10c |||OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 46 VQIRETGRSRKTMGQDEAK*QHDLREVQPSDAVPLPAVRAGLRPDSETGLPVRT 207 V + +T + E++ + RE++ + P VRA + P + LPV T Sbjct: 100 VHVSAVQLDNETDSEVESEVEELERELEAIEDSVYPEVRAAVNPTDDVNLPVNT 153 >SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 683 Score = 25.8 bits (54), Expect = 7.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 339 KQHRCCSTPP*NIFNNSKRSY 277 K R C TPP N+ NN K + Sbjct: 20 KASRLCFTPPTNLHNNKKNIF 40 >SPBC27.06c |mgr2||mitochondrial membrane protein Mgr1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 120 Score = 25.4 bits (53), Expect = 9.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 513 SEDVPLYSNSGTRYNAAYVNGDTN 584 +ED+PL SG+ +N +N + N Sbjct: 72 NEDIPLIQQSGSHWNQRLLNENAN 95 >SPAC10F6.17c ||SPAC56E4.01c|mitochondrial pyruvate dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 444 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 136 DAVPLPAVRAGLRPDSETGLPVRTEGPDIKTDN 234 +A+PL + G+ PD + L V G ++ +N Sbjct: 243 EAIPLSRDQTGMNPDEASRLEVEHPGEEVLRNN 275 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 25.4 bits (53), Expect = 9.8 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +3 Query: 144 TTTGSPCWSPSRQRDWSTSSDRRPRHKNGQSKLHQSQSENEQENYN 281 + + SP S S ++S R H N K H + N +YN Sbjct: 270 SASNSPALSGSSTPSNTSSRSNRQNHGNFSEKRHYDRYGNSHPSYN 315 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 25.4 bits (53), Expect = 9.8 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -1 Query: 667 LTINDKHQASPHEAWIKRTRTSDIESLTLVSPFTYAALYRVP-LFEYSGTSSDNSRNLNW 491 L +N S + R I L + TY L + + + ++N+ NL W Sbjct: 215 LILNKTDLISSEALSVVRQTILKINCLAKIIETTYGRLDDISEILDLDAYGNENTSNLEW 274 Query: 490 RVTVFEDSNRN 458 + DSN N Sbjct: 275 SIQRSNDSNIN 285 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,353,470 Number of Sequences: 5004 Number of extensions: 70214 Number of successful extensions: 188 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 402440190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -