BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30217 (823 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 26 1.6 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 26 1.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 3.7 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 6.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.6 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 8.6 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 8.6 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 499 DFDYYLKTCRCIQTVAP 549 D DYY +T RCI+ AP Sbjct: 100 DSDYYNRTYRCIERKAP 116 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 499 DFDYYLKTCRCIQTVAP 549 D DYY +T RCI+ AP Sbjct: 100 DSDYYNRTYRCIERKAP 116 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +3 Query: 180 QRDWSTSSDRRPRHKNGQSKLHQSQSENEQE 272 QRDW T ++R ++++ Q E E Sbjct: 1075 QRDWDTEREQRAASNREEAEIQQQLQREEDE 1105 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 177 RQRDWSTSSDRRPRHKNGQSKLHQSQSENEQENY 278 +Q+ W+T RP ++ Q + Q Q + + E Y Sbjct: 231 QQQLWTTVVRGRPSQRHRQPQQQQQQQQQQGERY 264 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.8 bits (49), Expect = 6.5 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 120 RSSAERCGTTTGSPCWSPSRQRDWSTSSDRRPRHKNGQSKLHQSQS 257 R+ ER GS SP+ QR W T RR L+Q+ S Sbjct: 387 RTGTERSFLYNGSQ--SPTGQRKWQTGPMRRVNTMLTSQMLNQTTS 430 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 550 RVPLFEYSGTSSDNSRNLNWRVTVFEDSNRNWCINK 443 RVP+FE+S + +N R RN+ N+ Sbjct: 2113 RVPMFEFSYNADGMVETMNVRTDPTHTFQRNFTYNE 2148 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 8.6 Identities = 17/69 (24%), Positives = 32/69 (46%) Frame = +3 Query: 363 FIEFQTLGI*LNMVSAHSLILIYWYSRLLMHQFRFESSKTVTLQLRFRLLSEDVPLYSNS 542 ++E + +G L V LILI + +LMH+F S + +L + + + ++ Sbjct: 976 YLELEPIG--LVFVMFFGLILIIQFVAMLMHRFGTISQILASTELNWYCSKKAKDMSLDA 1033 Query: 543 GTRYNAAYV 569 R NA + Sbjct: 1034 ELRENAVEI 1042 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 198 SSDRRPRHKNGQSKLHQSQSENEQE 272 S+ R+P H+ Q HQ + +Q+ Sbjct: 263 SAQRQPAHRQHQQWPHQQNGQQQQQ 287 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 840,022 Number of Sequences: 2352 Number of extensions: 16888 Number of successful extensions: 49 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -