BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30217 (823 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 69 5e-14 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 29 0.069 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 27 0.28 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.64 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 2.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 2.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 3.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 68.9 bits (161), Expect = 5e-14 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = +2 Query: 2 YCPSIIKWEDYALGKFRFVKPDEVAKLWGKMKQNDNMTFEKFSRAMRYHYRQSVLVSVPT 181 YCP IKW + G F+ V V++LWG K +M +E RA+RY+Y++ +L V Sbjct: 473 YCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRYYYQRGILAKVDG 532 Query: 182 ARLVYQF 202 RLVYQF Sbjct: 533 QRLVYQF 539 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 28.7 bits (61), Expect = 0.069 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 261 NEQENYNCVLNC*RCFREVLSNIDVVYR*NKSTNFIEFQTLG 386 +E+ N L C R EV+S+ D + NK + I+ +T+G Sbjct: 802 SEESINNQGLECLRFLNEVISDFDAILDQNKFKDIIKIKTIG 843 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 26.6 bits (56), Expect = 0.28 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -1 Query: 574 PFTYAALYRVPLFEYSGTSSDNSRNLNWRVTVFEDSNRNWCINKREYQY-ININECALTI 398 PFTYA+L R + E + NW F RN K ++ +++++C + + Sbjct: 506 PFTYASLIRQSIIESPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAVRHNLSLHKCFMRV 565 Query: 397 FN 392 N Sbjct: 566 EN 567 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.64 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 438 SRLLMHQFRFE-SSKTVTLQLRFRLLSEDVPLYSNSGTRYNAAYVNGDTNVKDS 596 ++ LMH+ S+ T T L VPL S+S N+ N +++ +DS Sbjct: 501 TKFLMHKDSLGLSTATSTCSLAVAKQQNQVPLTSSSNVNNNSGNGNTNSSARDS 554 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.4 bits (48), Expect = 2.6 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +3 Query: 177 RQRDWSTSSDRRPRHKNGQSKLHQSQSENEQENYNCVLNC*RCFREVLSNIDVV 338 R+R S D+R R ++ + K+ S S N N + N +++ NI+ + Sbjct: 60 RERSKERSRDKRERERSKERKIISSLSNNYISNISNYNNNNNYNKKLYYNINYI 113 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.4 bits (48), Expect = 2.6 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +3 Query: 177 RQRDWSTSSDRRPRHKNGQSKLHQSQSENEQENYNCVLNC*RCFREVLSNIDVV 338 R+R S D+R R ++ + K+ S S N N + N +++ NI+ + Sbjct: 60 RERSKERSRDKRERERSKERKIISSLSNNYISNISNYNNDNNYNKKLYYNINYI 113 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 511 NSRNLNWRVTVFEDSNRNWCINKREYQYINI 419 +S + N++ + + + N N+ N ++ QY NI Sbjct: 83 SSLSNNYKYSNYNNYNNNYNTNYKKLQYYNI 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,986 Number of Sequences: 438 Number of extensions: 4967 Number of successful extensions: 25 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -