BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30217 (823 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 34 0.099 At3g14840.2 68416.m01875 leucine-rich repeat family protein / pr... 29 2.8 At4g05540.1 68417.m00843 tRNA-splicing endonuclease positive eff... 29 4.9 At1g78110.1 68414.m09103 expressed protein 29 4.9 At1g12330.1 68414.m01425 expressed protein 29 4.9 At1g32950.1 68414.m04058 subtilase family protein contains simil... 28 6.5 At1g76850.1 68414.m08943 expressed protein 28 8.6 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 34.3 bits (75), Expect = 0.099 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 123 SSAERCGTTTGSPCWSPSRQRDWSTSSDRRPRHKNGQSKLHQSQS 257 SS R + +GS S SR R WS S R PRH + ++S+S Sbjct: 969 SSYSRSRSRSGSYSRSRSRSRSWSRSRSRSPRHSRDRGGHNRSRS 1013 >At3g14840.2 68416.m01875 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; contains 2 predicted transmembrane domains Length = 988 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 486 TLQLRF-RLLSEDVPLYSNSGTRYNAAYVNGDTNVKD 593 T+ L F ++ + +YSN G RY YV G VKD Sbjct: 468 TVNLHFAEIMFNEKNMYSNLGRRYFDIYVQGKREVKD 504 >At4g05540.1 68417.m00843 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 689 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +3 Query: 396 NMVSAHSLILIYWYSRLLMHQFRFESSKTVTLQLRFRLLSEDVPLYSNSGTRYNAAYVNG 575 N+ + LIL Y +S F SSK++++ ++ S +Y + TR A NG Sbjct: 10 NVDDLNPLILAYVFSVGDELHFSVHSSKSISIDEQYSFRSGFFLIYLTTNTRIWKALHNG 69 Query: 576 DTNV 587 D N+ Sbjct: 70 DGNL 73 >At1g78110.1 68414.m09103 expressed protein Length = 342 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 150 TGSPCWSPSRQRDWSTSSDRRPRHKNGQSKL 242 T P SPSR D ST+ RRP H+ SKL Sbjct: 33 TPKPICSPSRPSDSSTN--RRPHHRRQLSKL 61 >At1g12330.1 68414.m01425 expressed protein Length = 505 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 604 SDIESLTLVSPFTYAALYRVPLFEYSGTSSDNSRNLNWRVTVFEDSNR 461 S +SLT SP +A +P S +++D SR WR+ V E S++ Sbjct: 137 SIFQSLTRRSPKPSSATAALPPRSSSSSAADASREEQWRLAVAELSHK 184 >At1g32950.1 68414.m04058 subtilase family protein contains similarity to SBT1 GI:1771160 from [Lycopersicon esculentum] Length = 773 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 610 RTSDIESLTLVSPFTYAALYRVPLFEYSGTSSDNSRNL 497 + +D + V P +Y L +++Y G S+DNS+NL Sbjct: 89 KIADSPEVIHVIPDSYYELATTRIWDYLGPSADNSKNL 126 >At1g76850.1 68414.m08943 expressed protein Length = 1090 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +3 Query: 186 DWSTSSDRRPRHKNGQSKLHQSQSENEQENYNCVLNC*RCFREVLSNI 329 D S S+ R+ KNG S H Q E Y V++ R VLSNI Sbjct: 754 DLSQSTSRQDNWKNGYSDEH--QEEPSANTYGSVIDPHRRLLMVLSNI 799 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,934,751 Number of Sequences: 28952 Number of extensions: 344233 Number of successful extensions: 820 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1882599200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -