BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30214 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7927| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 1e-26 SB_2976| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8e-19) 39 0.003 SB_14133| Best HMM Match : TGS (HMM E-Value=2.2e-36) 36 0.031 SB_43010| Best HMM Match : MMR_HSR1 (HMM E-Value=1.9e-05) 34 0.12 SB_24089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_56785| Best HMM Match : TGS (HMM E-Value=6.2e-31) 32 0.50 SB_57810| Best HMM Match : MMR_HSR1 (HMM E-Value=3.6e-07) 31 0.66 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 31 1.2 SB_30377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) 29 4.7 SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 28 6.2 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 6.2 SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.2 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 28 6.2 SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) 28 6.2 SB_5246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_7927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 117 bits (281), Expect = 1e-26 Identities = 49/60 (81%), Positives = 58/60 (96%) Frame = +1 Query: 508 RQHLARLPSIDPYTRTIIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYQY 687 RQHL+RLPSIDP TRT+++CGFPNVGKSSF+NK+TRADV+VQPYAFTTKSL+VGH DY+Y Sbjct: 70 RQHLSRLPSIDPNTRTLLVCGFPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHMDYKY 129 Score = 76.2 bits (179), Expect(2) = 4e-17 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 252 IPKLDDVHPFYADLMNVLYDKDHYKLGLGQLNTARHLIDNV 374 +P DVHPFYADLMNVLYDKDHYKL LGQ+NTAR+LID + Sbjct: 12 VPTAKDVHPFYADLMNVLYDKDHYKLALGQINTARNLIDKM 52 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 49 MSLYNFKKIAVVPTAKD 99 M+ YNFKKI VVPTAKD Sbjct: 1 MAHYNFKKITVVPTAKD 17 Score = 29.5 bits (63), Expect(2) = 4e-17 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 438 RAALGRMATIMKRQGANLTYLEQ 506 R + +M TIMKRQ +L YLEQ Sbjct: 46 RNLIDKMCTIMKRQNQSLQYLEQ 68 >SB_2976| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8e-19) Length = 255 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 568 GFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDY 681 GFPN GKS+ + I+RA V Y FTT + VG +Y Sbjct: 2 GFPNAGKSTLLRAISRATPTVAAYPFTTLNPSVGMVEY 39 >SB_14133| Best HMM Match : TGS (HMM E-Value=2.2e-36) Length = 365 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 556 IIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDY 681 + + GFP+VGKS+ + K+T+ Y FTT + G +Y Sbjct: 66 VALIGFPSVGKSTLLTKLTQTQSACASYEFTTLTCIPGVINY 107 >SB_43010| Best HMM Match : MMR_HSR1 (HMM E-Value=1.9e-05) Length = 141 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 556 IIICGFPNVGKSSFINKITRADVEVQPYAFTT 651 + + GFP+VGKS+ + K+T+ Y FTT Sbjct: 66 VALIGFPSVGKSTLLTKLTQTQSACASYEFTT 97 >SB_24089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +1 Query: 553 TIIICGFPNVGKSSFINKITRA 618 T+ + GFPNVGKSS IN + R+ Sbjct: 457 TVGVVGFPNVGKSSIINSLKRS 478 >SB_56785| Best HMM Match : TGS (HMM E-Value=6.2e-31) Length = 303 Score = 31.9 bits (69), Expect = 0.50 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 568 GFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYQ 684 GFP+VGKS+ + + EV Y FTT + G Y+ Sbjct: 55 GFPSVGKSTLLTNLAGVYSEVAAYEFTTLTTVPGVIRYK 93 >SB_57810| Best HMM Match : MMR_HSR1 (HMM E-Value=3.6e-07) Length = 299 Score = 31.5 bits (68), Expect = 0.66 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +1 Query: 508 RQHLARLPSIDPYTRTIIICGFPNVGKSSFINKITRA-DVEVQPYAFTTKSL-YVGH 672 R +A LP D T TI + G+PNVGKSS IN I ++ V V TK YV H Sbjct: 149 RNAVADLPE-DALT-TIGLVGYPNVGKSSTINTILQSKKVAVSSTPGRTKHFQYVCH 203 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 556 IIICGFPNVGKSSFINKITRADVEVQPYAFTTKSL 660 +++ G NVGK+SF+ +T+ ++E P AF L Sbjct: 9 VVLTGDNNVGKTSFLINLTQNELEGTPTAFANYEL 43 >SB_30377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 562 ICGFPNVGKSSFINKITRADV-EVQPYAFTTK 654 + G+PNVGKSS IN + V +V P A TK Sbjct: 172 LIGYPNVGKSSIINTLKAKKVCKVAPIAGETK 203 >SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) Length = 1873 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 464 HHETARS*SYIPGTVVNI*HVYHR 535 HHET R +P V N H YHR Sbjct: 850 HHETRRYLDILPDLVTNYNHSYHR 873 >SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 464 HHETARS*SYIPGTVVNI*HVYHR 535 HHET R +P V N H YHR Sbjct: 588 HHETRRYLDILPDLVTNYNHSYHR 611 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 464 HHETARS*SYIPGTVVNI*HVYHR 535 HHET R +P V N H YHR Sbjct: 127 HHETRRYLDILPDLVDNYNHTYHR 150 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 464 HHETARS*SYIPGTVVNI*HVYHR 535 HHET R +P V N H YHR Sbjct: 484 HHETRRYLDILPDLVDNYNHTYHR 507 >SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 330 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 216 ELPRPTVQNYSGIPKLDDVHPFYADLMNV 302 ELP PT G P D+V+P AD++ V Sbjct: 124 ELPLPTSFANHGWPPKDEVYPLNADILKV 152 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 464 HHETARS*SYIPGTVVNI*HVYHR 535 HHET R +P V N H YHR Sbjct: 120 HHETRRYLDILPDLVDNYNHTYHR 143 >SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) Length = 879 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 137 LLQSFTSIIKYQEYVGFILEK*NIPSRTSTTDCPEL 244 L++S+ IIK QE GFI EK PS S DC E+ Sbjct: 534 LMKSYDDIIKEQEARGFI-EK--APSTPSLNDCLEV 566 >SB_5246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 261 LDDVHPFYADLMNVLYDKDHYKLG---LGQLNTARHLI 365 LDD F +L N L++++ KLG G+L A HL+ Sbjct: 483 LDDGRQFTTELFNTLHEEELAKLGGPSKGKLGQASHLL 520 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,812,212 Number of Sequences: 59808 Number of extensions: 458964 Number of successful extensions: 1048 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -