BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30214 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 24 5.2 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 6.8 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.8 bits (49), Expect = 5.2 Identities = 24/125 (19%), Positives = 48/125 (38%), Gaps = 1/125 (0%) Frame = +3 Query: 204 IYPAELPRPTVQNYSGIPKLDDVHPFYADLMNVLYDKDHYKLGLGQLNTARHLIDNVAKD 383 +YPA P V+ + ++ + + Y D Y GLG++ +L + V + Sbjct: 229 VYPASGPPDVVRK----DRRGELFYYMHQQLLARYQIDRYAQGLGRIEPLANLREPVREA 284 Query: 384 YV-RLLKYGDSLYRCKQLKRAALGRMATIMKRQGANLTYLEQSSTFSTFTIDRSLHQDDN 560 Y +LL+ ++ C + + +A R + +E ID D+ Sbjct: 285 YYPKLLRTSNNRTFCPRYPGMTISDVARSADRLEVRIADIESWLPRVLEAIDAGFAVSDD 344 Query: 561 HLWIP 575 + +P Sbjct: 345 GVRVP 349 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 499 WNSRQHLARLPSIDPYTRTIIICGFPNVGKSSFINKITRADVEVQPYAFT 648 WN R H + +D + + NV + + K+T A +E P T Sbjct: 514 WNPRAHQPMIALLDAWAPLLPAWILDNVLEQIVLVKLTAAVIEWDPLTDT 563 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,978 Number of Sequences: 2352 Number of extensions: 15800 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -