BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30213 (741 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch... 30 0.30 SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 29 0.92 SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 28 1.2 SPAP8A3.03 |||ZIP zinc transporter 1|Schizosaccharomyces pombe|c... 27 3.7 SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy... 26 6.5 SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy... 26 6.5 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 25 8.6 >SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 30.3 bits (65), Expect = 0.30 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 568 RESGKTFGANFSYFFHDFVIQRHVSRYVGWLLGCCRRVQIPHSQHVEK 425 + SG+ A +S +H F + H + WLLG R + SQHV++ Sbjct: 84 KSSGQQRAAYYSERYHSFRDKEHDTTLEKWLLGAYRGNEKFASQHVQE 131 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 28.7 bits (61), Expect = 0.92 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +3 Query: 84 NYSFRSEAGRVASVLYLINDGFAAEIDLLPSIRSSSKVDGLTDRALIYILVSNLTVQNII 263 NYSF + S +YL+N+ +LL +S+ + +TD A +Y N + +I+ Sbjct: 53 NYSFADH--KYNSGIYLLNESTRNHQELLVHGKSNKALTWITDSAFLYAREDNSSSSSIL 110 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 28.3 bits (60), Expect = 1.2 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 190 LDDRMDGSRSISAAKPSLIKYRTLATRPASLRKL*FIIDFSTIL 59 + +R++ I+ K +L RTL T +SLRKL + D TIL Sbjct: 331 IQNRLEEVMEIAKGKSNLAYLRTLQTVVSSLRKL--VADLKTIL 372 >SPAP8A3.03 |||ZIP zinc transporter 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 26.6 bits (56), Expect = 3.7 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -3 Query: 274 IYTVIIFCTVKLETRM*IRAL-SVRPSTLLDDRMDGSRSISAAKPSLIKYRTLATRPASL 98 +Y+++I V IR L RPS+L + DG + S KPS +T L Sbjct: 202 VYSILIGALVFFLMDKGIRILIHERPSSLSKPKKDGEETSSVNKPSASSTQTDVKGVEGL 261 Query: 97 RK 92 RK Sbjct: 262 RK 263 >SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1201 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 150 AAEIDLLPSIRSSSKVDGLTDRALIYILVSNLTVQNIITV*IYECHTLLFSR 305 AA +D+LP + SK LTD+ ++ ++N I V + +L SR Sbjct: 865 AASVDILPKVLPVSKTSDLTDKVNRRQRKNDKKIKNKIQVKLSSILEMLRSR 916 >SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 991 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 132 LINDGFAAEIDLLPSIRSSSKVDGLTDRALIYILVSNLTVQNI 260 LIN+ A + L + S V+ L AL LVSN T+QN+ Sbjct: 488 LINNRAANRLGLSREAAAVSSVNKLAASALKAQLVSNETLQNV 530 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 175 DGSRSISAAKPSLIKYRTLATRPASLRKL*FIIDFSTIL 59 D + + PSL+ + T+ T LR+ F +DF +L Sbjct: 319 DNPKFMITGTPSLVLFFTIFTNAYKLRQTNFTLDFLWVL 357 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,940,980 Number of Sequences: 5004 Number of extensions: 61643 Number of successful extensions: 163 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -