BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30213 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0153 - 22766805-22767023,22767662-22767940,22768294-227684... 29 3.9 09_02_0431 - 9327167-9327226,9327347-9327474,9327594-9327709,932... 29 5.1 08_02_0498 - 17815189-17815249,17815852-17815938,17816532-178165... 28 6.8 01_06_0117 + 26605186-26605443,26605540-26605583,26605659-266057... 28 6.8 >05_05_0153 - 22766805-22767023,22767662-22767940,22768294-22768401, 22768500-22768779,22768871-22769174,22769367-22769975, 22770186-22770411 Length = 674 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 329 FSLQRTTRARK*ERMALVDLHSNNILHCQVRNQNV 225 FSL+R + ALV LH NI+HC ++ +N+ Sbjct: 503 FSLRRIQAIARQCLEALVYLHHLNIVHCDLKPENI 537 >09_02_0431 - 9327167-9327226,9327347-9327474,9327594-9327709, 9327816-9327895,9328787-9328912,9329676-9329856, 9330514-9330578,9330655-9330915 Length = 338 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 93 NCNLLLISPLFYECYYTYKP 34 NCNL++I LF Y+ YKP Sbjct: 304 NCNLVIIDFLFRHGYHVYKP 323 >08_02_0498 - 17815189-17815249,17815852-17815938,17816532-17816587, 17816625-17816721,17817085-17817152 Length = 122 Score = 28.3 bits (60), Expect = 6.8 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 388 FTLFERISRPTFSFQHVVNEEFEHGDNTPTTIQHIDLRVVE*QNHEKNMKSLLRTSCHFL 567 + LF S+ FSFQ N + EHG + + Q + V+ E + SL S ++ Sbjct: 24 YILFANCSQELFSFQDARNMKMEHGQQSEAS-QFEEYCVLSVDTLENDAFSL---SSVWI 79 Query: 568 FNFCTV 585 ++ CTV Sbjct: 80 YSVCTV 85 >01_06_0117 + 26605186-26605443,26605540-26605583,26605659-26605737, 26605822-26605944,26606300-26606482,26606562-26606648, 26608149-26608255,26608387-26608474,26608805-26608885, 26608983-26609059,26609183-26609318,26609548-26609610, 26609983-26610563,26610816-26610933 Length = 674 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -2 Query: 272 LHSNNILHCQVRNQNVN*SPVSKTV 198 LHS+ + H ++R +NV+ SP+ K V Sbjct: 233 LHSHGLAHTELRLENVHVSPIDKHV 257 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,502,686 Number of Sequences: 37544 Number of extensions: 343134 Number of successful extensions: 775 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -