BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30213 (741 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 30 2.3 SB_20011| Best HMM Match : GED (HMM E-Value=0.65) 29 4.0 SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 28 9.1 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 31.1 bits (67), Expect = 0.98 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -2 Query: 287 MALVDLHSNNILHCQVRNQNVN*SPVS 207 +AL LHS NI+HC ++ +NV +P++ Sbjct: 598 LALKYLHSKNIVHCDLKPENVLLAPIT 624 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 196 TLLDDRMDGSRSISAAKPSLIKYRTLATRPASLRKL 89 T L +MDG++ + A+ L+K+R L P SLR L Sbjct: 11 TDLSMKMDGNKVLRTARQLLLKFRKLPFIPCSLRGL 46 >SB_20011| Best HMM Match : GED (HMM E-Value=0.65) Length = 427 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 436 VVNEEFEHGDNTPTTIQHIDLRVVE*QNHEKNMKSLLRT 552 VV + FE DN+P +H++ +++E +K K R+ Sbjct: 385 VVRKLFEFFDNSPKRQEHLEFKIIELLQKKKKKKRYFRS 423 >SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 648 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 118 ATRPASLRKL*FIIDFSTIL*MLLY--I*TFLFNHSIYL 8 AT P + R + I FS IL L+Y + FL H IYL Sbjct: 594 ATEPGNYRPISIICSFSKILEKLIYNQLIFFLEKHKIYL 632 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,107,851 Number of Sequences: 59808 Number of extensions: 424458 Number of successful extensions: 786 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -