BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30209 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharo... 27 3.8 SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pom... 25 8.8 >SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharomyces pombe|chr 1|||Manual Length = 1205 Score = 26.6 bits (56), Expect = 3.8 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 101 KRSHSLRKRMNDRRLNASSKDDASLPRRTTLSEQTIVKNYTE 226 K+S RK R+LN + + ++P R++ Q I NY+E Sbjct: 1138 KKSSRRRKNEKRRKLNEQNPNIRNVPERSSSRFQGIRINYSE 1179 >SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 781 Score = 25.4 bits (53), Expect = 8.8 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 5/33 (15%) Frame = -2 Query: 679 YLHTYRI-----GTLALSHPLIRVHKAS*PLSH 596 +L TYR+ GTL L+HP +R A+ L+H Sbjct: 584 WLRTYRVFFLNNGTLPLNHPYVRGCLATYELAH 616 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,405,051 Number of Sequences: 5004 Number of extensions: 47293 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -