BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30209 (755 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.4 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 7.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.4 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 553 VLVKTNLMSRIYRSRGLKVKKP 618 +L KTN +SRI+ + K+P Sbjct: 739 LLTKTNRISRIFNASKHSAKRP 760 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 559 VKTNLMSRIYRSRGLKVKKPCVLVSKDAT 645 ++T++MSR Y +R + ++K + D+T Sbjct: 296 LQTSIMSRHYSTRAIVIEKGQSIWDYDST 324 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +3 Query: 282 RDLTIFYNGDTVHNFI*ITFYTKSNFYSSNSKVKMIVLQIEL 407 R T+FY + + + I+F T FY + + + L I + Sbjct: 241 RRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISI 282 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +3 Query: 282 RDLTIFYNGDTVHNFI*ITFYTKSNFYSSNSKVKMIVLQIEL 407 R T+FY + + + I+F T FY + + + L I + Sbjct: 241 RRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISI 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,283 Number of Sequences: 438 Number of extensions: 3617 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -