BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30208 (550 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 36 0.004 SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit ... 27 2.4 SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces p... 26 4.2 SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo... 26 4.2 SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase ... 25 7.3 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 25 7.3 SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|... 25 9.7 SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyce... 25 9.7 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 35.9 bits (79), Expect = 0.004 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 272 DDGELHALKRVP-PRGTAQLTFYTPSRTGRIIYTVYIMSDSYMGLDQQYDLQFEIIDAMP 448 DD L A+K++ R + P G + Y + SDSYMG+D + + + +++ + Sbjct: 2110 DDKTLLAIKKITLGRSLTTKMEFVPPAMGTLKYKLSCFSDSYMGVDYEKEFECNVLEPLD 2169 Query: 449 SENVD 463 +E D Sbjct: 2170 TEMED 2174 >SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit Sec63 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 26.6 bits (56), Expect = 2.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 317 TAQLTFYTPSRTGRIIYTVYIMSDSYMGLD 406 T ++ F P G + ++IMS+SY+G D Sbjct: 512 TFRIPFQVPPVAGTFSFQLHIMSNSYVGED 541 >SPAC13G7.08c |crb3||WD repeat protein Crb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 25.8 bits (54), Expect = 4.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 195 GNPNNVLCPRFPRGKNEGWF*RSAPWTMESCTP*N 299 G P+NVLC G F +S+P +CT N Sbjct: 13 GEPSNVLCHNLHTGTLVSTFRQSSPAKNATCTTLN 47 >SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizosaccharomyces pombe|chr 1|||Manual Length = 1604 Score = 25.8 bits (54), Expect = 4.2 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 33 DLPTTDIKLHVRGLWFDADHEQD-KRITQPPARDQWMPLHADQEYTLLLDMQRRGGNPNN 209 DLP+ V + FD+D E+D +R+ A++ + +E++ L D R+ +PNN Sbjct: 754 DLPSATNTASVSEINFDSDEEEDIRRLAVESAQE---AVQKAREHSQLFDANRQ-QSPNN 809 >SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase Ppk6|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.0 bits (52), Expect = 7.3 Identities = 9/47 (19%), Positives = 24/47 (51%) Frame = +2 Query: 353 GRIIYTVYIMSDSYMGLDQQYDLQFEIIDAMPSENVDKVYDTIEKTL 493 G ++YT+ + Y +++ D + I + +NVD + +++ + Sbjct: 697 GILLYTIVYRENPYYNIEEILDAKLRIPFELSKDNVDLICRMLDRNV 743 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 88 IMNKTNGSRNLPPGISGCLCMLI 156 I+N+TNG + +P I G + LI Sbjct: 423 ILNETNGGKQIPALIVGIIACLI 445 >SPBC1D7.03 |mug80||cyclin Clg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 461 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 207 CSDCRLYVAYPIAGYIPDQHAKAST 133 CS+C Y Y GY P + A T Sbjct: 437 CSNCNYYYPYTPVGYYPVYNRYAMT 461 >SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 818 Score = 24.6 bits (51), Expect = 9.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 316 SSRRDPFQGVQLSIVHGAERQNQPSFLPRGNLGHS 212 SS+ PF + + VH +N PS + R N HS Sbjct: 408 SSKASPFN--KPNSVHSEASRNTPSSIDRENASHS 440 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,215,946 Number of Sequences: 5004 Number of extensions: 44181 Number of successful extensions: 108 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -