BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30207 (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 28 0.29 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 28 0.29 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 25 2.0 CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 25 2.0 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 2.7 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 24 4.7 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 6.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 6.3 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 8.3 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 27.9 bits (59), Expect = 0.29 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 219 GRHCGFGKRRGTPMRVCHRRNY 284 G+HCG+ + G ++V H R++ Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 27.9 bits (59), Expect = 0.29 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 219 GRHCGFGKRRGTPMRVCHRRNY 284 G+HCG+ + G ++V H R++ Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -2 Query: 314 IFLKPFVFVPIVPSVAYAHWCTSSLTKATVTTLSTCFCVFADTSAGVYC 168 I +K F+ ++ + C +++ TVT STC AD + + C Sbjct: 12 IIMKSFIAAAVIALI-----CAIAVSGTTVTLQSTCKLFTADVVSSITC 55 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 25.0 bits (52), Expect = 2.0 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -2 Query: 293 FVPIVPSVAYAHWCTSSLTKATVTTLSTCFCVFADTSAGVYCYRFLDDETILDHL 129 F+ VPS + WCT+ TK T + D + Y R + + DHL Sbjct: 172 FLGKVPSKHFLPWCTTGGTKKLRTLHKK---LIEDGAEEWYLVRIVPRRNLFDHL 223 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 2.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 51 CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 164 CG K++ +DP E+ +R+M K+ ++ K+P Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 254 CTSSLTKATVTTLSTCFCVFADTSAGVYC 168 C +++ TVT STC AD + + C Sbjct: 14 CAIAVSGTTVTLQSTCKLFTADVVSSITC 42 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 455 TKMLSDQAEARRNKVKEAASAARNVLPPRR-RNCCR 559 T+ +SD R AAS+ N L PR NC R Sbjct: 8 TEAMSDSGYDSRTDGNGAASSCNNSLNPRTPPNCAR 43 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 455 TKMLSDQAEARRNKVKEAASAARNVLPPRR-RNCCR 559 T+ +SD R AAS+ N L PR NC R Sbjct: 8 TEAMSDSGYDSRTDGNGAASSCNNSLNPRTPPNCAR 43 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 102 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 194 N ++ +R IK+GL + +PVA + RA R Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,244 Number of Sequences: 2352 Number of extensions: 12262 Number of successful extensions: 50 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -