BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30204 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) 99 4e-21 SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) 33 0.26 SB_526| Best HMM Match : GRP (HMM E-Value=8.5) 31 1.1 SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) 31 1.1 SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) 28 7.5 SB_23574| Best HMM Match : efhand (HMM E-Value=2e-05) 28 7.5 >SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) Length = 327 Score = 99.1 bits (236), Expect = 4e-21 Identities = 44/67 (65%), Positives = 54/67 (80%) Frame = +3 Query: 72 KMTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNSKTA 251 K TIGK++KM HINYR+R LQD R FIGTF AFDKHMN+ILGDC+EFRKIK K+SK Sbjct: 23 KPTIGKSSKMLLHINYRMRCTLQDGRVFIGTFLAFDKHMNVILGDCDEFRKIKGKSSKAQ 82 Query: 252 DEKKKEL 272 + ++K + Sbjct: 83 EREEKRV 89 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +2 Query: 254 REEKRTLGFVLLRGENIVSLTI 319 REEKR LG VLLRGE++VS+T+ Sbjct: 84 REEKRVLGLVLLRGEHLVSMTV 105 >SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +3 Query: 87 KNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEF 218 + +++ +N +RV + D RT IG+F DK N+ILG C+EF Sbjct: 29 QRKELESWLNKLMRVKISDGRTLIGSFLCTDKDRNIILGSCQEF 72 >SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) Length = 75 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +3 Query: 111 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 215 ++ R+ V +++ R G A+D+H+N+IL D EE Sbjct: 24 LDERIYVKMRNDRELRGRLHAYDQHLNMILSDVEE 58 >SB_526| Best HMM Match : GRP (HMM E-Value=8.5) Length = 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +3 Query: 540 HDGWPSSRNDGSSSWHGSWWART-GSSRNAT 629 +DGW ++ DG ++ +G W T G+ RNAT Sbjct: 85 YDGWNATNGDGWNATNGDGWNGTNGNGRNAT 115 >SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) Length = 443 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/51 (29%), Positives = 30/51 (58%) Frame = +3 Query: 114 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNSKTADEKKK 266 N +V + +++R + KAFD+H N++L E +++ ++ K+ KKK Sbjct: 29 NTQVLINCRNNRKLLARVKAFDRHCNMVL---ENVKEMWTETPKSGKGKKK 76 >SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 51 YLPNHSDKMTIGKNNKMQQHINY--RVRVILQDSR 149 ++P H+ M IGK +M + I + RVR I+ SR Sbjct: 334 FIPEHAMGMVIGKKGRMLEEIKHKTRVRPIIDKSR 368 >SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) Length = 661 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +3 Query: 87 KNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNSKTADEKK- 263 ++ +M +H YR + L+DS F + NL L CE + +++ + + KK Sbjct: 485 RHQRMMRHNQYRELLGLRDSLDFSSNMEDSHATQNLRLSTCELTKSLRNFSKELPFIKKG 544 Query: 264 -KELWV-LFFY 290 E + LFFY Sbjct: 545 HAETQINLFFY 555 >SB_23574| Best HMM Match : efhand (HMM E-Value=2e-05) Length = 69 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 153 FIGTFKAFDKHMNLILGDCEEFRKIKSKNSKTADEKKKELWVLF 284 F+ FK FD++ N ++G E + S K +DE+ L V F Sbjct: 7 FMECFKVFDRNGNGLIGAAELRHLLASLGDKLSDEEVDNLMVGF 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,553,484 Number of Sequences: 59808 Number of extensions: 349508 Number of successful extensions: 725 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -