BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30203 (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 27 0.14 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 27 0.14 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.2 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 6.7 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 27.1 bits (57), Expect = 0.14 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 181 LARNPAMLQELMRSHD--RALSNLESIQVVTMRSKE 282 LA +M+ RS+D LSNLESIQ+ +++ KE Sbjct: 119 LAMLTSMVMFYKRSNDLKTLLSNLESIQIYSIKPKE 154 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 27.1 bits (57), Expect = 0.14 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 181 LARNPAMLQELMRSHD--RALSNLESIQVVTMRSKE 282 LA +M+ RS+D LSNLESIQ+ +++ KE Sbjct: 75 LAMLTSMVMFYKRSNDLKTLLSNLESIQIYSIKPKE 110 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 69 SGSFIICCTNGLSKTCLSISGLD 1 +GS ++C +NGL T S S L+ Sbjct: 49 AGSNLLCASNGLVTTLASGSSLN 71 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 26 VLDNPLVQQMMNDPENMRT 82 +L P + ++NDP+N +T Sbjct: 335 LLSYPEICTLLNDPQNAKT 353 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,749 Number of Sequences: 336 Number of extensions: 3407 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -