BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30203 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.6 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.1 AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like pepti... 24 3.7 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 24 4.9 AY748832-1|AAV28180.1| 69|Anopheles gambiae cytochrome P450 pr... 24 4.9 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 24 4.9 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 452 SFPGQCLCGRLRLRSRPHQTPGMQSLLQQ 538 + P + + + L+ HQTP Q LLQQ Sbjct: 1316 ALPCRLIIPDMDLQQMEHQTPAQQQLLQQ 1344 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = -2 Query: 344 ERVPCHATGHIEHRFLYVPIHSLERIVTTWILSRLERARSCERINSCNI 198 ER HATG + HR V + + RI L +E RI++C I Sbjct: 1475 ERSTLHATGLLSHRLYDVLGNEIGRINK---LGSIENLSFQSRISNCRI 1520 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = -2 Query: 344 ERVPCHATGHIEHRFLYVPIHSLERIVTTWILSRLERARSCERINSCNI 198 ER HATG + HR V + + RI L +E RI++C I Sbjct: 1476 ERSTLHATGLLSHRLYDVLGNEIGRINK---LGSIENLSFQSRISNCRI 1521 >AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like peptide 4 precursor protein. Length = 160 Score = 24.2 bits (50), Expect = 3.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 558 RRGFSDICCRRDC 520 RR +D CCR DC Sbjct: 129 RRDVADECCREDC 141 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 29 LDNPLVQQMMNDPENMRTSSPPTHKCK-ISCLEIQKSVIC 145 L N ++Q + N P+ T+ P KC+ S E+ V C Sbjct: 121 LKNMVLQDISNQPKQQSTTR-PLRKCRNKSTCELDHCVFC 159 >AY748832-1|AAV28180.1| 69|Anopheles gambiae cytochrome P450 protein. Length = 69 Score = 23.8 bits (49), Expect = 4.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 518 MQSLLQQMSENPRLVQSMVSSPYTNSMLQ 604 +Q +L + S +PR VQ + PY + +++ Sbjct: 8 LQEVLDRSSSDPRSVQDYQNLPYLDRVIK 36 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 29 LDNPLVQQMMNDPENMRTSSPPTHKCK-ISCLEIQKSVIC 145 L N ++Q + N P+ T+ P KC+ S E+ V C Sbjct: 122 LKNMVLQDISNQPKQQSTTR-PLRKCRNKSTCELDHCVFC 160 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,460 Number of Sequences: 2352 Number of extensions: 15240 Number of successful extensions: 34 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -