BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30203 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 25 0.84 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.1 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 3.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.9 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.9 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 5.9 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 24.6 bits (51), Expect = 0.84 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 317 HIEHRFLYVPIHSLERI--VTTWILSRLERARSCERINSCNI 198 H+ H + + L + + TW+ L+ +RINSC++ Sbjct: 94 HVSHTCIENHLKQLGYVQKLDTWVPHELKEKHLTQRINSCDL 135 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 497 RPHQTPGMQSLLQQMSENPRLVQSMVSSPYTNS 595 RP +P S ++ NP L+QS S Y ++ Sbjct: 413 RPQVSPDRTSPMEYRLYNPALIQSQPSPQYPST 445 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 542 SENPRLVQSMVSSPYTNSMLQGLNA 616 S NP +Q+ +SP T S+ L+A Sbjct: 21 SANPGTIQACTTSPATASLESSLSA 45 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 597 MELVYGEETIDWT 559 MELVY TID+T Sbjct: 154 MELVYAWSTIDYT 166 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +1 Query: 154 PELLRQTMELARNPAMLQEL 213 P+ + MEL +NP L+ + Sbjct: 268 PDFINMLMELQKNPQKLENI 287 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +3 Query: 234 PLQSRKYPGGYNALQRMYRDIQE 302 PL+ + P G+ ++ Y++I+E Sbjct: 399 PLELKGSPDGFESVTSQYKNIRE 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,783 Number of Sequences: 438 Number of extensions: 4070 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -