BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30202 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 25 0.61 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 25 0.61 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 1.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 1.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 23 2.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.6 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 25.0 bits (52), Expect = 0.61 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 541 HQTAVSRELSCHVFVYLSLKSVSV--LNYVWV 452 H+T + R +S FVY+ L ++ L YVW+ Sbjct: 127 HETNLLRNVSVQFFVYVILYILATVFLAYVWI 158 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 25.0 bits (52), Expect = 0.61 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 541 HQTAVSRELSCHVFVYLSLKSVSV--LNYVWV 452 H+T + R +S FVY+ L ++ L YVW+ Sbjct: 127 HETNLLRNVSVQFFVYVILYILATVFLAYVWI 158 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 428 VRHGEEGDDPHIVEDRNRLKAKIDE 502 +R E+ +DPH+ E L + IDE Sbjct: 47 IRTSEDDNDPHVNEYVESLASIIDE 71 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 428 VRHGEEGDDPHIVEDRNRLKAKIDE 502 +R E+ +DPH+ E L + IDE Sbjct: 361 IRTSEDDNDPHVNEYVESLASIIDE 385 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 428 VRHGEEGDDPHIVEDRNRLKAKIDE 502 +R E+ +DPH+ E L + IDE Sbjct: 594 IRTSEDDNDPHVNEYVESLASIIDE 618 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 428 VRHGEEGDDPHIVEDRNRLKAKIDE 502 +R E+ +DPH+ E L + IDE Sbjct: 594 IRTSEDDNDPHVNEYVESLASIIDE 618 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 541 VAPSVSSSRGPSKPPVDAIEEPAVRN 618 +A +V+S+ GPS+ P + E +RN Sbjct: 271 LASAVASANGPSQDPSISSTETLLRN 296 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 671 LLDPSGLGPAGDASLAAKF 615 ++D S +GP+GD KF Sbjct: 661 IVDDSDVGPSGDCFYENKF 679 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,068 Number of Sequences: 336 Number of extensions: 3428 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -