BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30202 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 27 3.5 SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 3.5 SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Sc... 26 4.7 SPCC2H8.02 |||inorganic phosphate transporter|Schizosaccharomyce... 26 6.2 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 25 8.2 >SPBC15D4.13c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 212 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 241 ETIRYFSLIRNDRRDMDGTGTPLTNR*YVGKIPV 140 E+++YF L ND + G P + +G IPV Sbjct: 20 ESLKYFKLTSNDPMILSGFRGPRVSHLTIGMIPV 53 >SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 860 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 665 DPSGLGPAGDASLAAKFLTAGSSIASTGG 579 +PSGLG G L+ K T GS +S G Sbjct: 126 NPSGLGTHGKVRLSIKLSTGGSGGSSVTG 154 >SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Schizosaccharomyces pombe|chr 1|||Manual Length = 564 Score = 26.2 bits (55), Expect = 4.7 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 541 VAPSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPA 645 +A ++S P +PP ++ ++P++ N + SP+ Sbjct: 436 IAEGIASLLNPEEPPSNSDKQPSMSNGPKSEVSPS 470 >SPCC2H8.02 |||inorganic phosphate transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 583 Score = 25.8 bits (54), Expect = 6.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 493 DRRRHGMKVLERPQFDVAPSVSSSRGPSKPPVDAIEE 603 D++ G V RP +VAPS + SR PS V++ E Sbjct: 298 DKKNPG-SVHIRPNNEVAPSSAPSRAPSTTSVESNTE 333 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 25.4 bits (53), Expect = 8.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 427 DTDYRKVSHIVLSEWRRH*QLWTRFLNTFIHI 332 D +YR+ + ++L+ R WT + F HI Sbjct: 197 DAEYRETNELLLTVTREWIDRWTEVCDAFQHI 228 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,780,534 Number of Sequences: 5004 Number of extensions: 57912 Number of successful extensions: 156 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -