BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30202 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54710| Best HMM Match : Linker_histone (HMM E-Value=6e-38) 32 0.53 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 31 0.93 SB_44458| Best HMM Match : Filament (HMM E-Value=1) 30 2.2 SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) 29 5.0 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_44827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_54710| Best HMM Match : Linker_histone (HMM E-Value=6e-38) Length = 234 Score = 31.9 bits (69), Expect = 0.53 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +1 Query: 514 KVLERPQFDVAPSVSSSRGPSKPPVDAIEEPAVRNFAAKDAS--PAGPK 654 K ++P +P ++++ PSK P A ++PA + AAK A+ PA K Sbjct: 156 KAAKKPAAKKSPKKAAAKKPSKSPKKAAKKPAAKKPAAKKAAKKPAAKK 204 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 526 RPQFDVAPSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPAGP 651 RPQ AP + P +PP +++P ++ FA P+ P Sbjct: 888 RPQQPPAPMPPQQQSPYQPPAPTMQQPQLQAFAPFSPQPSQP 929 >SB_44458| Best HMM Match : Filament (HMM E-Value=1) Length = 748 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 362 PELLMPPPLAQNDVGDFPVVGIVRHGEEGDDPHIVEDRNRLKAKIDE 502 P++ +PPPL D+GD P+V ++ I E R L+ +E Sbjct: 534 PKVPVPPPLQMPDIGDAPLVKDTSSAKDRKQKVIEELRGELRRAKNE 580 >SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) Length = 813 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 162 QRFVNGVPVPSISRRSFRIREKYLIVSVLLTSE 260 +RFV+G PS+SR SF K+ + S L T++ Sbjct: 222 RRFVSGSGAPSVSRESFYGDNKFALWSDLRTTD 254 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/71 (28%), Positives = 31/71 (43%) Frame = -2 Query: 272 LTTRFRRQKYRNNQIFLSYTERPPRYGRDGYPVNKPLIRR*NSRHVYQLLRIYT*YTKNI 93 +TTR R+ + N+ +YT PPR R+ + + R Y R T K Sbjct: 87 ITTRRTRKGFSRNESITNYTPSPPRTKRNTHAAKSRRDSLASYRSSYGASRAQT-KQKTK 145 Query: 92 NRDSSTHNRQP 60 N+ S + + QP Sbjct: 146 NKKSLSADSQP 156 >SB_44827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +3 Query: 150 LPTYQRFVNGVPVPSISRRSFRIREKYLIVSVLLTSESCG*ELCFIYLNL 299 + T ++ V +PV ISRR + RE + +L + G LC++++ + Sbjct: 31 ISTLRKVVFKLPVLRISRRFWNARENFKFAEILF-AFGLGQLLCYVFIEI 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,211,761 Number of Sequences: 59808 Number of extensions: 445317 Number of successful extensions: 1182 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -