BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30202 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 26 0.31 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.0 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.0 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 6.7 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.8 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 8.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.8 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 26.2 bits (55), Expect = 0.31 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 514 SCHVFVYLSLKSVSVL-NYVWVVTFFAMPNDTD 419 SC VFV+LSL +V+ NY+ V AM +D Sbjct: 282 SCSVFVFLSLMEFAVVNNYMGPVATKAMKGYSD 314 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +3 Query: 54 RLGLTVV--CRTVSIYIFSILGV 116 RL VV C T ++Y+ S++G+ Sbjct: 150 RLSFCVVLACSTATVYVMSVVGL 172 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 80 STHNRQPQSAVAIKLKSFQRRAA 12 S+H+R + AVA +L+ QR A Sbjct: 158 SSHSRSQEKAVAAELEDEQRLLA 180 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 653 LGPAGDASLAAKFLTAGSSIASTGGLLGPR 564 LG A A L GSS + +LGPR Sbjct: 176 LGAVDIAGSGAVHLVGGSSALACAIMLGPR 205 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 Query: 511 CHVFVYLSLKSVSVLNYVW 455 C VFV+ +L + +NY + Sbjct: 311 CFVFVFAALLEYAAVNYTY 329 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 617 TSQLKTHLLLVLNQTGLIDTSLLLSV 694 T QLK ++ + Q GL+D LS+ Sbjct: 66 TRQLKCYMYCLWEQFGLVDDKRELSL 91 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.8 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 434 HGEEGDDPH 460 HG+EG+DP+ Sbjct: 84 HGKEGEDPY 92 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 179 GTRPVHISAVVPYKREISD 235 G P+H Y REISD Sbjct: 926 GFGPIHYGVCSNYLREISD 944 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,533 Number of Sequences: 438 Number of extensions: 4607 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -