BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30202 (717 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51040.2 68416.m05589 expressed protein contains Pfam PF05608... 30 1.3 At3g51040.1 68416.m05588 expressed protein contains Pfam PF05608... 30 1.3 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 30 1.3 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 30 1.3 At1g70060.1 68414.m08061 paired amphipathic helix repeat-contain... 29 2.3 At5g55770.1 68418.m06951 DC1 domain-containing protein contains ... 29 3.1 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 3.1 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 3.1 At2g40220.1 68415.m04946 abscisic acid-insensitive 4 (ABI4) iden... 29 4.1 At1g24520.1 68414.m03087 anther-specific protein agp1 identical ... 29 4.1 >At3g51040.2 68416.m05589 expressed protein contains Pfam PF05608: Protein of unknown function (DUF778) Length = 231 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 589 QQEACWD--LEKKIQKVQHQTAVSRELSCHVFVYLSLKSVSVLNYVWVVTFFA 437 ++E WD L K Q+ QH + +CH FV +L +S+ + W V A Sbjct: 114 EKEPTWDDALRKSTQEYQHHSYNILTCNCHSFVANNLNRLSIKSGGWNVVNLA 166 >At3g51040.1 68416.m05588 expressed protein contains Pfam PF05608: Protein of unknown function (DUF778) Length = 231 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 589 QQEACWD--LEKKIQKVQHQTAVSRELSCHVFVYLSLKSVSVLNYVWVVTFFA 437 ++E WD L K Q+ QH + +CH FV +L +S+ + W V A Sbjct: 114 EKEPTWDDALRKSTQEYQHHSYNILTCNCHSFVANNLNRLSIKSGGWNVVNLA 166 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +1 Query: 544 APSVSSSRGPSKPPVDAIEE--PAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNAD 705 AP+ S+ P+K PV+A E P+ + SP P P+ ++ A I P+AD Sbjct: 50 APTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPSPE-ADTPSAPEIAPSAD 104 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +1 Query: 544 APSVSSSRGPSKPPVDAIEE--PAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNAD 705 AP+ S+ P+K PV+A E P+ + SP P P+ ++ A I P+AD Sbjct: 50 APTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPSPE-ADTPSAPEIAPSAD 104 >At1g70060.1 68414.m08061 paired amphipathic helix repeat-containing protein similar to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1362 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 431 ERYRLQESLPHRFERVAEALTALDPLSEYVYTHCKHC 321 ERYR ++ R E+VA + P+SE ++C+ C Sbjct: 432 ERYRERDREKERLEKVAASQKWAKPISELDLSNCEQC 468 >At5g55770.1 68418.m06951 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 695 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 705 ISVRTDSNSDVSIRPVWFRTSRRCVFSCEVPNSGLLYC 592 I +R NS +S RPV R +RRC F L+YC Sbjct: 644 IFIRVHLNSSLS-RPVCSRCNRRCPFPIFFKGLRLIYC 680 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = +1 Query: 544 APSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNA 702 AP + SS GP +PP A P + K P GPK G +++GP A Sbjct: 376 APQMPSSAGPPRPPPPA---PPPGSGGPKPPPPPGPK--GPRPPPPMSLGPKA 423 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = +1 Query: 544 APSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNA 702 AP + SS GP +PP A P + K P GPK G +++GP A Sbjct: 376 APQMPSSAGPPRPPPPA---PPPGSGGPKPPPPPGPK--GPRPPPPMSLGPKA 423 >At2g40220.1 68415.m04946 abscisic acid-insensitive 4 (ABI4) identical to AP2 domain transcription factor ABI4 GI:4587996 from [Arabidopsis thaliana]; sucrose uncoupled-6 (sun6) mutation PMID: 10972884 Length = 328 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/64 (26%), Positives = 25/64 (39%) Frame = +1 Query: 526 RPQFDVAPSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNAD 705 R Q ++ PS SS S V A P+ + + + P P+P + GP Sbjct: 105 RAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGI 164 Query: 706 PDQN 717 P N Sbjct: 165 PFNN 168 >At1g24520.1 68414.m03087 anther-specific protein agp1 identical to agp1 GI:780177 from [Arabidopsis thaliana] Length = 125 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +1 Query: 544 APSVSSSRGPSKPPVDAIEEPAVRNFAAKDASPAGPKPDGSNRYVAVAIGPNADPD 711 +PS S S+ P+ D +E P + A P P + VA +G ++ D Sbjct: 28 SPSASPSKAPAASKTDHVEAPVTDDQIGTTDDDAAPTPGDGDVAVAGPLGSDSSYD 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,657,705 Number of Sequences: 28952 Number of extensions: 306436 Number of successful extensions: 889 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -