BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30201 (654 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0991 - 10057736-10058249,10058412-10059241,10059266-100606... 29 3.2 01_06_1480 - 37660591-37660720,37660899-37660930,37661061-376611... 29 3.2 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 28 7.5 09_02_0033 + 3145326-3145458,3146122-3146135,3146172-3146255,314... 27 9.9 >12_01_0991 - 10057736-10058249,10058412-10059241,10059266-10060633, 10061785-10062327,10066274-10066498,10066590-10066640 Length = 1176 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = -1 Query: 498 PVLINFSSAIGVAVYHLSFNKLLIYSVTSIWISHNENVRNIIMFGHFHLYLLIQKTQLSK 319 P L N S + + S+N+L YSV W+SH ++++++M H +L + Sbjct: 442 PQLGNLSKLAYLDLTSYSYNQL--YSVALSWLSHLSSLKHLVM-NHVNLTTAVDWVDEIN 498 Query: 318 YIPQL 304 +P L Sbjct: 499 MLPAL 503 >01_06_1480 - 37660591-37660720,37660899-37660930,37661061-37661155, 37661460-37661527,37661608-37661694,37662884-37662912, 37663019-37663138,37663854-37663905,37663986-37664050, 37664174-37664536,37664637-37664711,37664803-37664940, 37665025-37665181,37665471-37665478,37665576-37665710, 37665965-37666082,37666791-37666915,37667571-37667717, 37668297-37668380,37668671-37668800,37669196-37669347, 37669678-37669857,37670660-37670731,37671104-37671295, 37671366-37671411,37671498-37671647,37671725-37671882, 37671995-37672101,37672191-37672407,37672484-37672696, 37672852-37672972,37673072-37673253,37673475-37673672, 37674770-37674967 Length = 1447 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 492 LINFSSAIGVAVYHLSFNKLLIYSVTSIWISHNENVRNIIMFGHFHLYLLIQK 334 L NF + V H FN +IY++ + SH + N + L LL+ K Sbjct: 631 LYNFCKVLSVKCSHSIFNWEMIYAILEVLFSHRNELTNHVE-AACDLLLLVSK 682 >07_03_0435 + 18182657-18183509,18184477-18184574,18184663-18184833, 18185524-18185624,18185702-18185837,18186007-18186057, 18186202-18186489,18186610-18186844,18186924-18187204, 18187336-18187557 Length = 811 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -1 Query: 519 PAPCKWSPVLINFSSAIGVAVYHL--SFNKLLIYSVTSIWISHNENVRNIIMFG 364 P P +W P +F ++I + + L S + L Y TS+ ++ + R ++ G Sbjct: 537 PYPFQWGPPTFHFKTSIIMVIVSLVASVDSLSSYHATSLLVNLSPPTRGVVSRG 590 >09_02_0033 + 3145326-3145458,3146122-3146135,3146172-3146255, 3147330-3147406,3149093-3149516 Length = 243 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 444 FNKLLIYSVTSIWISHNENVRN 379 FN L+IY+ IW+ N+ V N Sbjct: 192 FNGLIIYTTWGIWLQRNDQVFN 213 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,017,175 Number of Sequences: 37544 Number of extensions: 262584 Number of successful extensions: 503 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -