BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30201 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.8 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.8 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 24 4.8 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 24 4.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.4 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 593 PYYSTEIMERVPKIFMALTSRRARTPPHVSG 501 PYYST + R+ + S+ +P +SG Sbjct: 383 PYYSTTTLNRIARFTNRAPSKEDLSPSSLSG 413 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 593 PYYSTEIMERVPKIFMALTSRRARTPPHVSG 501 PYYST + R+ + S+ +P +SG Sbjct: 383 PYYSTTTLNRIARFTNRAPSKEDLSPSSLSG 413 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/39 (25%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 504 WSPVLINFSSAIGVAVYHLSFNKLLIYSVTSI-WISHNE 391 W P ++ +++A G +H +L+YS + W+ E Sbjct: 119 WRPDVVLYNNAGGSDQHHYGDTNVLVYSEGKVLWVPPTE 157 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 612 LTQFKGPLLFHRNNGKGSENFYGTHQQ 532 L QF PL N+G + N G HQQ Sbjct: 59 LKQFDLPLGNTGNSGNNNNNGVGNHQQ 85 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +1 Query: 361 MPKHDYVSYIFIMGNPYACD 420 +P+ + +I GNP+ CD Sbjct: 700 VPEDKQIPEFYIGGNPFVCD 719 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,020 Number of Sequences: 2352 Number of extensions: 12089 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -