BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30201 (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82073-6|CAB04924.1| 333|Caenorhabditis elegans Hypothetical pr... 31 0.94 AF260242-1|AAF97548.1| 333|Caenorhabditis elegans palmitoyl-CoA... 31 0.94 Z95123-2|CAB08356.1| 339|Caenorhabditis elegans Hypothetical pr... 28 6.7 AY652946-1|AAT73713.1| 708|Caenorhabditis elegans guanylate cyc... 28 6.7 AF260244-1|AAF97550.1| 339|Caenorhabditis elegans stearoyl-CoA ... 28 6.7 AF038609-4|AAU87824.1| 708|Caenorhabditis elegans Guanylyl cycl... 28 6.7 >Z82073-6|CAB04924.1| 333|Caenorhabditis elegans Hypothetical protein W06D12.3 protein. Length = 333 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -1 Query: 570 GKGSENFYGTHQQ---TSTHPAPCKWSPVLINFSSAIGV 463 G+G N++ T Q TS H W+ VLI+F ++IG+ Sbjct: 262 GEGGHNYHHTFPQDYRTSEHAEFLNWTRVLIDFGASIGM 300 >AF260242-1|AAF97548.1| 333|Caenorhabditis elegans palmitoyl-CoA fatty acid desaturaseFAT-5 protein. Length = 333 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -1 Query: 570 GKGSENFYGTHQQ---TSTHPAPCKWSPVLINFSSAIGV 463 G+G N++ T Q TS H W+ VLI+F ++IG+ Sbjct: 262 GEGGHNYHHTFPQDYRTSEHAEFLNWTRVLIDFGASIGM 300 >Z95123-2|CAB08356.1| 339|Caenorhabditis elegans Hypothetical protein VZK822L.1 protein. Length = 339 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -1 Query: 570 GKGSENFYGTHQQ---TSTHPAPCKWSPVLINFSSAIGV 463 G+G NF+ T Q TS + W+ VLI+ ++A+G+ Sbjct: 271 GEGGHNFHHTFPQDYRTSEYSLKYNWTRVLIDTAAALGL 309 >AY652946-1|AAT73713.1| 708|Caenorhabditis elegans guanylate cyclase-like protein protein. Length = 708 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/68 (25%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -1 Query: 576 NNGKGSENFYGTHQQTSTHPAPCKW--SPVLINFSSAIGVAVYHLSFNKLLIYSVTSIWI 403 N+ KG F+ +T AP S +L+ + YH+ FNK +I I++ Sbjct: 192 NHRKGKRLFHKFRNTKTTENAPSFTLSSTILVGLRDFKNIFPYHVCFNKQMIIEHIGIYL 251 Query: 402 SHNENVRN 379 + N Sbjct: 252 LREYGLEN 259 >AF260244-1|AAF97550.1| 339|Caenorhabditis elegans stearoyl-CoA desaturase FAT-6 protein. Length = 339 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -1 Query: 570 GKGSENFYGTHQQ---TSTHPAPCKWSPVLINFSSAIGV 463 G+G NF+ T Q TS + W+ VLI+ ++A+G+ Sbjct: 271 GEGGHNFHHTFPQDYRTSEYSLKYNWTRVLIDTAAALGL 309 >AF038609-4|AAU87824.1| 708|Caenorhabditis elegans Guanylyl cyclase protein 37 protein. Length = 708 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/68 (25%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -1 Query: 576 NNGKGSENFYGTHQQTSTHPAPCKW--SPVLINFSSAIGVAVYHLSFNKLLIYSVTSIWI 403 N+ KG F+ +T AP S +L+ + YH+ FNK +I I++ Sbjct: 192 NHRKGKRLFHKFRNTKTTENAPSFTLSSTILVGLRDFKNIFPYHVCFNKQMIIEHIGIYL 251 Query: 402 SHNENVRN 379 + N Sbjct: 252 LREYGLEN 259 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,880,480 Number of Sequences: 27780 Number of extensions: 255684 Number of successful extensions: 553 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -