BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30200 (788 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0491 - 25605560-25605684,25605826-25605928,25606026-256075... 29 3.2 06_03_0493 + 21402536-21404599 29 5.6 06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 28 9.7 >04_04_0491 - 25605560-25605684,25605826-25605928,25606026-25607592, 25608694-25610198 Length = 1099 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = -2 Query: 430 GATVASGDLNCRTPLPTLALCR*ISELQLDDYRSTLST---CPLHKTVLLTSPLHKLPKI 260 G +SGD R PTL + + + T +T C H T+L S L LPK+ Sbjct: 866 GDHTSSGDFQSRIAFPTLETLKFTDMESWEHWDETEATDFPCLRHLTILNCSKLTGLPKL 925 Query: 259 KHVVFVFVNYC 227 +V + + C Sbjct: 926 LALVDLRIKNC 936 >06_03_0493 + 21402536-21404599 Length = 687 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +1 Query: 115 CFCIIQLYVNIFGFYKSLIKKNVVANLLMPCAHVEGVCNSSRKRRQRVLF 264 CFC +G++ ++ ++ V+AN++ V+ C R LF Sbjct: 267 CFCKFGRMETAYGYFAAMKREGVMANVVTFSTFVDAFCKEGLVREAMKLF 316 >06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 Length = 1613 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 404 KLPHSTSNTSAMSVNLRTTT**LQVNTFNLSPTQDGAPYFSP 279 K+ + +S+ S RT+ V TF +SP+ D P+F P Sbjct: 1212 KIRRLSIRSSSYSSAQRTSNSVAHVRTFRMSPSIDNIPFFFP 1253 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,987,006 Number of Sequences: 37544 Number of extensions: 306996 Number of successful extensions: 551 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -