BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30200 (788 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) 29 5.7 >SB_56578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 520 QLNTNTHASQVT*LTHVLTKYTSIHAR 600 Q NTNTH S TH L YT +H++ Sbjct: 1002 QHNTNTHLSPTHRHTHYLPPYTFLHSQ 1028 >SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) Length = 2057 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 516 NATKYKHARVSSNVTDSRTHKIHKYSCSLMPQSSTITDSP*GLELLYLL 662 N+ K A+V S ++ S K+ C LM + ++ P G ++ YL+ Sbjct: 1040 NSLSSKAAKVKSKISSSFFKKVTTVECRLMKKKNSDISLPFGSKIQYLI 1088 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,679,552 Number of Sequences: 59808 Number of extensions: 396486 Number of successful extensions: 651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -