BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30200 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 2.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 2.0 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 3.5 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -2 Query: 334 RSTLSTCPLHKTVLLTSPLHKLPKIKHVVFVFVNYCIRPLHGHKA*VSWPQ 182 R +S P+H VLL P H L H + Y H ++ S PQ Sbjct: 158 REPISPGPIHPAVLLPYPQHVLHPAHHPALLHPAYHTGLHHYYQPSPSHPQ 208 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -2 Query: 334 RSTLSTCPLHKTVLLTSPLHKLPKIKHVVFVFVNYCIRPLHGHKA*VSWPQ 182 R +S P+H VLL P H L H + Y H ++ S PQ Sbjct: 158 REPISPGPIHPAVLLPYPQHVLHPAHHPALLHPAYHTGLHHYYQPSPSHPQ 208 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 3.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 788 HQSIFSHFLQVTDK 747 H+S+F HF+ +T K Sbjct: 923 HESLFKHFINITSK 936 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,679 Number of Sequences: 2352 Number of extensions: 13362 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -