BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30200 (788 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62680.1 68414.m07074 pentatricopeptide (PPR) repeat-containi... 31 0.87 At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putat... 30 1.5 At1g76390.1 68414.m08877 armadillo/beta-catenin repeat family pr... 28 8.1 >At1g62680.1 68414.m07074 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 542 Score = 31.1 bits (67), Expect = 0.87 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 148 FGFYKSLIKKNVVANLLMPCAHVEGVCNSSR 240 F F+K + +K + N++ A V G+CNSSR Sbjct: 204 FDFFKEIERKGIRPNVVTYTALVNGLCNSSR 234 >At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putative similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 366 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 151 GFYKSLIKKNVVANLLMPCAHVEGVCNSSRKRRQRV 258 G Y+S I + VV ++ C V G +SSR++R RV Sbjct: 96 GNYRSRIMERVVEAFIVRCPIVAGEASSSRQKRLRV 131 >At1g76390.1 68414.m08877 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 811 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 160 KSLIKKNVVANLLMPCAHVEGVCNSSRKRRQRV 258 +SL N N+L+ +V +C + RK RQRV Sbjct: 110 QSLYLGNAETNILLALKNVREICRNIRKIRQRV 142 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,357,321 Number of Sequences: 28952 Number of extensions: 265597 Number of successful extensions: 484 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -