BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||... 28 0.61 SPCC645.05c |myo2|rng5|myosin II heavy chain|Schizosaccharomyces... 27 1.4 SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu... 26 1.9 SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyc... 26 2.5 SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual 25 3.3 SPBC14C8.04 |||acetolactate synthase regulatory unit|Schizosacch... 25 4.3 SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 4.3 SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ... 25 5.7 SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schi... 25 5.7 SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccha... 25 5.7 SPAC1F7.12 |yak3|yakC, SPAC21E11.01|aldose reductase YakC|Schizo... 25 5.7 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 25 5.7 SPBC12C2.11 ||SPBC21D10.02|glutamine-fructose-6-phosphate transa... 24 10.0 >SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 565 Score = 27.9 bits (59), Expect = 0.61 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -1 Query: 292 STVSISKNSAIIGLICPVQKYYSRIKIYHLWKSYSTICTVHVP*GHLSARGYT 134 + V ++ S I GL P S I+HLW ++S + H+ G L A G T Sbjct: 472 NVVFVANPSEIRGLHLP-----SITHIFHLWSTFSGVAYQHIA-GRLGAMGQT 518 >SPCC645.05c |myo2|rng5|myosin II heavy chain|Schizosaccharomyces pombe|chr 3|||Manual Length = 1526 Score = 26.6 bits (56), Expect = 1.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 203 VEELLNDLYGSCPLRPPIGEGLHYINLPHA 114 +E+ +N+L G+ P G+ L ++NL HA Sbjct: 1431 LEKQVNELKGAEVSPQPTGQSLQHVNLAHA 1460 >SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1405 Score = 26.2 bits (55), Expect = 1.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 329 WCRIEVGICSTHQYSVYF*K 270 WCR+E+G S SV F K Sbjct: 495 WCRVEIGCSSPQNISVSFEK 514 >SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 688 Score = 25.8 bits (54), Expect = 2.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 302 NKFQPQSDTIALYWKIGISRNPNPFQEYRPFSN 400 N F PQ + + ++ S +P Q RPF+N Sbjct: 198 NNFSPQLRSPKISHRLQTSATSSPLQHKRPFTN 230 >SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 413 Score = 25.4 bits (53), Expect = 3.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 260 YRSNMSSAKILFSYQNIPFVE 198 YRSN S+++I F +N P V+ Sbjct: 88 YRSNTSASEIHFQAENAPLVQ 108 >SPBC14C8.04 |||acetolactate synthase regulatory unit|Schizosaccharomyces pombe|chr 2|||Manual Length = 289 Score = 25.0 bits (52), Expect = 4.3 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 204 CGRATQRFVRFMSLEATYR-RGATLHQPAPRP 112 CGR RFVR S AT LH +P P Sbjct: 6 CGRLANRFVRLKSTSATSPITYKALHANSPLP 37 >SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 25.0 bits (52), Expect = 4.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 120 PRPAHYFSDVLMLGIIICMVFTTFKKIPLKRVYLVPFPVN 1 P FS+VL+ +I + F IPL R +P N Sbjct: 614 PNSISSFSEVLLPNLISTLNFAPLSLIPLLRKSFLPLSYN 653 >SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 24.6 bits (51), Expect = 5.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -3 Query: 260 YRSNMSSAKILFSYQNIPFVEELLNDLYGSC 168 +R+ + ++NIP+ E L +L G C Sbjct: 457 FRTKGNGPMCFVEFENIPYAMEALKNLQGVC 487 >SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 466 Score = 24.6 bits (51), Expect = 5.7 Identities = 8/26 (30%), Positives = 20/26 (76%) Frame = -3 Query: 254 SNMSSAKILFSYQNIPFVEELLNDLY 177 ++ ++A++LF ++N+P V +N+L+ Sbjct: 390 ADRNAARVLFVHRNVPGVLRQVNELF 415 >SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 24.6 bits (51), Expect = 5.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 160 GHLSARGYTTSTCPTPRALLQRRLNARYHN 71 GH++ GY S P +L + L AR HN Sbjct: 501 GHINDLGYQMSLIPLLPSLARAVLAAREHN 530 >SPAC1F7.12 |yak3|yakC, SPAC21E11.01|aldose reductase YakC|Schizosaccharomyces pombe|chr 1|||Manual Length = 340 Score = 24.6 bits (51), Expect = 5.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 278 NRHCTGAWNKFQPQSDTIALYWKIGISRNP 367 N C G W K + I L K G +NP Sbjct: 61 NEECIGRWFKQTGRRKEIFLATKFGYEKNP 90 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 24.6 bits (51), Expect = 5.7 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 203 VEELLNDLYGSCPLRPPIGEG 141 ++EL ++ C +RPP+G+G Sbjct: 467 IQELKGNIRVFCRVRPPLGDG 487 >SPBC12C2.11 ||SPBC21D10.02|glutamine-fructose-6-phosphate transaminase |Schizosaccharomyces pombe|chr 2|||Manual Length = 696 Score = 23.8 bits (49), Expect = 10.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 260 YRSNMSSAKILFSYQNIPFVEELLNDLYGSCP 165 Y S ++ + NIP V EL +D CP Sbjct: 394 YHSCVAVRPLFEELTNIPVVVELASDFVDRCP 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,852,308 Number of Sequences: 5004 Number of extensions: 39290 Number of successful extensions: 99 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -