BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 24 2.4 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 4.1 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 22 7.2 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.8 bits (49), Expect = 2.4 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -1 Query: 157 HLSARGYTTSTCPTPRALLQRRLNARYHNMYG 62 H+S G P R L R L R N YG Sbjct: 89 HISPAGSIARNSPAARFLSDRGLTPRDFNSYG 120 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 200 EELLNDLYGSCPLRPP 153 ++ L ++G CP RPP Sbjct: 245 QQRLTGVHGGCPWRPP 260 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 22.2 bits (45), Expect = 7.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 99 SDVLMLGIIICMVFTTFKKIPLKRVYLVPFPV 4 SDV +L I C++ T +KI + L PV Sbjct: 224 SDVALLRIFECLLEVTLQKILQLTIVLSTGPV 255 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,256 Number of Sequences: 2352 Number of extensions: 9324 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -