BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U05040-1|AAA17976.2| 644|Homo sapiens FUSE binding protein prot... 29 5.7 BC017247-1|AAH17247.1| 653|Homo sapiens FUBP1 protein protein. 29 5.7 AB209366-1|BAD92603.1| 493|Homo sapiens far upstream element-bi... 29 5.7 >U05040-1|AAA17976.2| 644|Homo sapiens FUSE binding protein protein. Length = 644 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 251 NMSSAKILFSYQNIPFVEELLNDLYGSC--PLRPPIGEGLHYINLPHAP 111 NM I + Q I + +L+ + G PL PP+ G H + PH P Sbjct: 423 NMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGP 471 >BC017247-1|AAH17247.1| 653|Homo sapiens FUBP1 protein protein. Length = 653 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 251 NMSSAKILFSYQNIPFVEELLNDLYGSC--PLRPPIGEGLHYINLPHAP 111 NM I + Q I + +L+ + G PL PP+ G H + PH P Sbjct: 422 NMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGP 470 >AB209366-1|BAD92603.1| 493|Homo sapiens far upstream element-binding protein variant protein. Length = 493 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 251 NMSSAKILFSYQNIPFVEELLNDLYGSC--PLRPPIGEGLHYINLPHAP 111 NM I + Q I + +L+ + G PL PP+ G H + PH P Sbjct: 273 NMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGP 321 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,744,788 Number of Sequences: 237096 Number of extensions: 1436882 Number of successful extensions: 2158 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2158 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2870859500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -