BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X92892-1|CAA63485.1| 1876|Drosophila melanogaster phosphoinositi... 29 1.7 U52192-1|AAC47117.1| 1876|Drosophila melanogaster phosphoinositi... 29 1.7 AY058587-1|AAL13816.1| 1876|Drosophila melanogaster LD28067p pro... 29 1.7 AE014296-2027|AAF50012.1| 1876|Drosophila melanogaster CG11621-P... 29 1.7 AE014296-2026|AAF50011.1| 1876|Drosophila melanogaster CG11621-P... 29 1.7 >X92892-1|CAA63485.1| 1876|Drosophila melanogaster phosphoinositide 3-kinase protein. Length = 1876 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 328 GVGLRLEFVPRTSTVSISKNSAIIGLICPVQKYYSRIKIY 209 G G L FVPR T+ I+ ++C QK+YS K Y Sbjct: 1591 GSGELLSFVPRKYTMQQDGRLKIVKVVC-FQKHYSMEKFY 1629 >U52192-1|AAC47117.1| 1876|Drosophila melanogaster phosphoinositide 3-kinase protein. Length = 1876 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 328 GVGLRLEFVPRTSTVSISKNSAIIGLICPVQKYYSRIKIY 209 G G L FVPR T+ I+ ++C QK+YS K Y Sbjct: 1591 GSGELLSFVPRKYTMQQDGRLKIVKVVC-FQKHYSMEKFY 1629 >AY058587-1|AAL13816.1| 1876|Drosophila melanogaster LD28067p protein. Length = 1876 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 328 GVGLRLEFVPRTSTVSISKNSAIIGLICPVQKYYSRIKIY 209 G G L FVPR T+ I+ ++C QK+YS K Y Sbjct: 1591 GSGELLSFVPRKYTMQQDGRLKIVKVVC-FQKHYSMEKFY 1629 >AE014296-2027|AAF50012.1| 1876|Drosophila melanogaster CG11621-PC, isoform C protein. Length = 1876 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 328 GVGLRLEFVPRTSTVSISKNSAIIGLICPVQKYYSRIKIY 209 G G L FVPR T+ I+ ++C QK+YS K Y Sbjct: 1591 GSGELLSFVPRKYTMQQDGRLKIVKVVC-FQKHYSMEKFY 1629 >AE014296-2026|AAF50011.1| 1876|Drosophila melanogaster CG11621-PA, isoform A protein. Length = 1876 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 328 GVGLRLEFVPRTSTVSISKNSAIIGLICPVQKYYSRIKIY 209 G G L FVPR T+ I+ ++C QK+YS K Y Sbjct: 1591 GSGELLSFVPRKYTMQQDGRLKIVKVVC-FQKHYSMEKFY 1629 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,478,877 Number of Sequences: 53049 Number of extensions: 409366 Number of successful extensions: 872 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1149697725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -