BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 2.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 3.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 3.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 6.9 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 2.2 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 4 YWEWH*IYAFQ 36 +W WH +Y F+ Sbjct: 209 HWHWHLVYPFE 219 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 3.9 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = +2 Query: 257 YNSTIFRNRHCTGAWNKFQPQSDTIALYWKIGISRNPN 370 YN+ F+ + T AW + + S + I + P+ Sbjct: 116 YNAKDFQTFYKTAAWARLRMNSGMFTTAFSIAVLYRPD 153 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 3.9 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = +2 Query: 257 YNSTIFRNRHCTGAWNKFQPQSDTIALYWKIGISRNPN 370 YN+ F+ + T AW + + S + I + P+ Sbjct: 116 YNAKDFQTFYKTAAWARLRMNSGMFTTAFSIAVLYRPD 153 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 6.9 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 283 SISKNSAIIGLICPVQKYYSRIKIYHL 203 S++ + + CP YYS I + L Sbjct: 623 SLNSTNVTLSTKCPYPSYYSYIGVLTL 649 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,478 Number of Sequences: 438 Number of extensions: 2691 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -