BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30199X (400 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g48050.1 68415.m06014 expressed protein ; expression supporte... 29 1.1 At4g12390.1 68417.m01958 invertase/pectin methylesterase inhibit... 27 3.5 At5g17250.1 68418.m02021 phosphatidylinositolglycan class O (PIG... 27 4.6 At5g20220.1 68418.m02407 zinc knuckle (CCHC-type) family protein... 26 8.0 At3g18290.1 68416.m02326 zinc finger protein-related weak alignm... 26 8.0 At2g32295.1 68415.m03948 EXS family protein / ERD1/XPR1/SYG1 fam... 26 8.0 >At2g48050.1 68415.m06014 expressed protein ; expression supported by MPSS Length = 1500 Score = 29.1 bits (62), Expect = 1.1 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -2 Query: 183 FVRFMSLEATYRRGATLHQPAPRPAHYFSDVLMLGIIICMVFTTFKKIPLK 31 F RF++ A L + P F V +LG++IC F IP K Sbjct: 167 FERFLAWHGQKILFAALFYASLSPISVFGFVYLLGLVICTTFPKSSSIPSK 217 >At4g12390.1 68417.m01958 invertase/pectin methylesterase inhibitor family protein low similarity to pectinesterase from Arabidopsis thaliana SP|Q42534, Lycopersicon esculentum SP|Q43143; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 206 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 395 KMAGIPGTD*DSYLYQFSNIELW 327 K G G D D +L++ SN+E W Sbjct: 129 KQVGRSGRDRDEFLWRLSNVETW 151 >At5g17250.1 68418.m02021 phosphatidylinositolglycan class O (PIG-O) family protein similar to Pig-o [Mus musculus] GI:8099973 Length = 884 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = -2 Query: 177 RFMSLEATYRRGATLHQPAPRPAHYFSDVLMLGIIICMVFTTFKKIPLKRVY 22 +FMS ++ G PA A + +L + I+IC+++ K P + V+ Sbjct: 580 QFMSSSPSWMLGIAPDHPALTYAIEIAPILSVVILICVLYVAIAKAPNEGVW 631 >At5g20220.1 68418.m02407 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 393 Score = 26.2 bits (55), Expect = 8.0 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -1 Query: 145 RGYTTSTCPTPRALLQRRLNARYH 74 +G+ TCP ++++ + ++ RYH Sbjct: 298 KGHNRRTCPKSKSIVTKGISTRYH 321 >At3g18290.1 68416.m02326 zinc finger protein-related weak alignment to Pfam profiles: PF00097 Zinc finger, C3HC4 type (RING finger) (2 copies) Length = 1254 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 97 RRLNARYHNMYGFYYI*ENSIETRIFSAIPSK 2 R+ R+H ++GFY N+ + +F A+ SK Sbjct: 696 RQFIGRFHLLWGFYKAHSNAEDDILFPALESK 727 >At2g32295.1 68415.m03948 EXS family protein / ERD1/XPR1/SYG1 family protein low similarity to xenotropic and polytropic murine leukemia virus receptor [Mustela vison] GI:6093316; contains Pfam profile PF03124: EXS family Length = 424 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 268 SAIIGLICPVQKYYSRIKIYHLWKSYSTICTVH 170 SA+I LI P +Y + Y LW + + VH Sbjct: 137 SAVIILIIPFNIFYMSSRYYLLWTFWRILFPVH 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,470,021 Number of Sequences: 28952 Number of extensions: 198380 Number of successful extensions: 422 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -