BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30198 (520 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 28 0.050 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 5.7 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 28.3 bits (60), Expect = 0.050 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 374 VKEILGTAQSVGCTVEGRPPHDLIDDINSGALTIDE*MFLISI*KKKKK 520 +K L T QSV C E +IDDIN G + +D+ L+ I KK Sbjct: 22 LKSGLHTVQSV-CMKEIGTAQQIIDDINEGKINMDDENVLLFIECTMKK 69 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 269 KQKNIKHNGNISLEDVIGIAKIMRNRSMARYLS 367 K+K I + +++ D G+ + NR+ YL+ Sbjct: 131 KKKGINNGIIVNINDASGLNLLPMNRNRPAYLA 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,952 Number of Sequences: 438 Number of extensions: 3503 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -