BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30198 (520 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S ... 128 3e-30 At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S ... 128 3e-30 At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) 128 3e-30 At4g31260.1 68417.m04437 hypothetical protein 30 1.1 At3g47110.1 68416.m05115 leucine-rich repeat transmembrane prote... 30 1.1 At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, p... 29 1.9 At2g16270.1 68415.m01863 expressed protein and genefinder; expr... 29 2.5 At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding ... 28 4.3 At1g80300.1 68414.m09401 chloroplast ADP, ATP carrier protein 1 ... 27 5.7 At4g02640.2 68417.m00359 bZIP transcription factor family protei... 27 7.6 At4g02640.1 68417.m00358 bZIP transcription factor family protei... 27 7.6 >At5g60670.1 68418.m07614 60S ribosomal protein L12 (RPL12C) 60S RIBOSOMAL PROTEIN L12 (like), Arabidopsis thaliana, PIR:T45883 Length = 166 Score = 128 bits (308), Expect = 3e-30 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 1/84 (1%) Frame = +3 Query: 6 DPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKITVQLTV 182 DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T+ +WKGL++TV+LTV Sbjct: 6 DPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTV 65 Query: 183 QNRQAQIAVVPSAAALIIRALKEP 254 QNRQA++ VVPSAAAL+I+ALKEP Sbjct: 66 QNRQAKVTVVPSAAALVIKALKEP 89 Score = 107 bits (258), Expect = 3e-24 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = +2 Query: 257 RDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEILGTAQSVGCTVEGRPPH 436 RDRKK KNIKHNGNIS +DVI IAKIMR RS+A+ LSG+VKEILGT SVGCTV+G+ P Sbjct: 91 RDRKKVKNIKHNGNISFDDVIEIAKIMRPRSIAKELSGTVKEILGTCVSVGCTVDGKDPK 150 Query: 437 DLIDDINSGALTI 475 DL ++INSG + I Sbjct: 151 DLQEEINSGDIDI 163 >At3g53430.1 68416.m05896 60S ribosomal protein L12 (RPL12B) 60S RIBOSOMAL PROTEIN L12, Prunus armeniaca, SWISSPROT:RL12_PRUAR Length = 166 Score = 128 bits (308), Expect = 3e-30 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 1/84 (1%) Frame = +3 Query: 6 DPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKITVQLTV 182 DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T+ +WKGL++TV+LTV Sbjct: 6 DPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTV 65 Query: 183 QNRQAQIAVVPSAAALIIRALKEP 254 QNRQA++ VVPSAAAL+I+ALKEP Sbjct: 66 QNRQAKVTVVPSAAALVIKALKEP 89 Score = 100 bits (240), Expect = 5e-22 Identities = 48/75 (64%), Positives = 58/75 (77%) Frame = +2 Query: 257 RDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEILGTAQSVGCTVEGRPPH 436 RDRKK KNIKHNGNIS +DV IA+IMR RS+A+ LSG+V+EILGT SVGCTV+G+ P Sbjct: 91 RDRKKVKNIKHNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGKDPK 150 Query: 437 DLIDDINSGALTIDE 481 DL +I G + I E Sbjct: 151 DLQQEIQEGEIEIPE 165 >At2g37190.1 68415.m04562 60S ribosomal protein L12 (RPL12A) Length = 166 Score = 128 bits (308), Expect = 3e-30 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 1/84 (1%) Frame = +3 Query: 6 DPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKITVQLTV 182 DP++I V +R GGEVGA SSLAPKIGPLGL+PKK+G+DIAK T+ +WKGL++TV+LTV Sbjct: 6 DPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTV 65 Query: 183 QNRQAQIAVVPSAAALIIRALKEP 254 QNRQA++ VVPSAAAL+I+ALKEP Sbjct: 66 QNRQAKVTVVPSAAALVIKALKEP 89 Score = 99.5 bits (237), Expect = 1e-21 Identities = 47/75 (62%), Positives = 58/75 (77%) Frame = +2 Query: 257 RDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEILGTAQSVGCTVEGRPPH 436 RDRKK KNIKHNGNIS +DV IA+IMR RS+A+ LSG+V+EILGT SVGCTV+G+ P Sbjct: 91 RDRKKVKNIKHNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGKDPK 150 Query: 437 DLIDDINSGALTIDE 481 D+ +I G + I E Sbjct: 151 DIQQEIQDGEVEIPE 165 >At4g31260.1 68417.m04437 hypothetical protein Length = 63 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 495 IRNIYSSMVKAPLLMSSIRSCGGLPSTV 412 IR++Y VK+ + + IRSCGG+ ++V Sbjct: 28 IRSLYPDKVKSEIPIQDIRSCGGVLASV 55 >At3g47110.1 68416.m05115 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 receptor type precursor, Oryza sativa, PIR:A57676 Length = 1025 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/67 (23%), Positives = 34/67 (50%) Frame = -2 Query: 456 LMSSIRSCGGLPSTVHPTDCAVPRISFTEPERYRAIDLFLMIFAIPITSSREMLPLCLIF 277 + +I CGG+PS + C+V P R+ ++ + I + ++ +L LC+++ Sbjct: 622 VFGNINLCGGIPS-LQLQPCSVEL-----PRRHSSVRKIITICVSAVMAALLLLCLCVVY 675 Query: 276 FCFLRSR 256 C+ + R Sbjct: 676 LCWYKLR 682 >At1g15500.1 68414.m01865 chloroplast ADP, ATP carrier protein, putative / ADP, ATP translocase, putative / adenine nucleotide translocase, putative strong similarity to SP|Q39002 Chloroplast ADP,ATP carrier protein 1, chloroplast precursor (ADP/ATP translocase 1) (Adenine nucleotide translocase 1) {Arabidopsis thaliana}; contains Pfam profile PF03219: TLC ATP/ADP transporter Length = 618 Score = 29.1 bits (62), Expect = 1.9 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -2 Query: 333 IFAIPITSSREMLPLCLIFFCFL 265 IF + +T+ ++++PL L+FFC L Sbjct: 102 IFGVEVTTLKKIVPLGLMFFCIL 124 >At2g16270.1 68415.m01863 expressed protein and genefinder; expression supported by MPSS Length = 759 Score = 28.7 bits (61), Expect = 2.5 Identities = 25/85 (29%), Positives = 39/85 (45%) Frame = +3 Query: 51 EVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITVQLTVQNRQAQIAVVPSAAAL 230 EVG+ + LA G S + G+ IA TSD LK+ N ++ +V S+ L Sbjct: 554 EVGSYNDLAKGDAESG-SEEGFGE-IAAETSDDLHLKVRSSNKAYNDSTKLMIVLSSTVL 611 Query: 231 IIRALKEPLVIVKSRKISNTTATSP 305 ++ A+ V K K+ T +P Sbjct: 612 VLLAVAS-FVFAKKTKLVAATKPAP 635 >At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding subunit (ClpD), (ERD1) SAG15/ERD1; identical to ERD1 protein GI:497629, SP:P42762 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain Length = 945 Score = 27.9 bits (59), Expect = 4.3 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = +3 Query: 48 GEVGATSSLAPKIGPLGLSPKKVG-DDIAKATSDWKGLKITVQLTVQNRQAQIAVVPSAA 224 GE+ SSL P G P VG DDIA S W G+ + Q+T R +++ Sbjct: 570 GELVEESSLPPAAGDD--EPILVGPDDIAAVASVWSGIPVQ-QITADERMLLMSLEDQLR 626 Query: 225 ALIIRALKEPLVIVKSRKISNTTATSPLR 311 ++ + I ++ K S P R Sbjct: 627 GRVVGQDEAVAAISRAVKRSRVGLKDPDR 655 >At1g80300.1 68414.m09401 chloroplast ADP, ATP carrier protein 1 / ADP, ATP translocase 1 / adenine nucleotide translocase 1 (AATP1) identical to SP|Q39002 Chloroplast ADP,ATP carrier protein 1, chloroplast precursor (ADP/ATP translocase 1) (Adenine nucleotide translocase 1) {Arabidopsis thaliana} Length = 624 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 333 IFAIPITSSREMLPLCLIFFCFL 265 IF + + + ++++PL L+FFC L Sbjct: 105 IFGVEVATLKKIIPLGLMFFCIL 127 >At4g02640.2 68417.m00359 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; identical to cDNA bZIP protein BZO2H1, alternatively spliced GI:10954094 Length = 417 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 48 GEVGATSSLAPKIGPLGLSPKKVGDDIAKATSD 146 GE+G TSSL ++ G+S K+V ++ SD Sbjct: 171 GELGVTSSLPAEVKKTGVSMKQVTSGSSREYSD 203 >At4g02640.1 68417.m00358 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; identical to cDNA bZIP protein BZO2H1, alternatively spliced GI:10954094 Length = 411 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 48 GEVGATSSLAPKIGPLGLSPKKVGDDIAKATSD 146 GE+G TSSL ++ G+S K+V ++ SD Sbjct: 165 GELGVTSSLPAEVKKTGVSMKQVTSGSSREYSD 197 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,050,124 Number of Sequences: 28952 Number of extensions: 251762 Number of successful extensions: 720 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -