BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30196X (509 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pomb... 29 0.53 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 1.6 SPBC19F5.01c |puc1|SPBP8B7.32c|cyclin Puc1|Schizosaccharomyces p... 27 2.2 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 26 2.9 SPBC1289.11 |spf38|cwf17|splicing factor Spf38|Schizosaccharomyc... 26 3.8 SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces... 25 5.0 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 25 5.0 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 5.0 SPAC4G8.04 |||GTPase activating protein |Schizosaccharomyces pom... 25 6.6 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 25 6.6 SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizos... 25 6.6 SPAC22F3.09c |res2|mcs1, pct1|MBF transcription factor complex s... 25 8.7 SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosacc... 25 8.7 SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 25 8.7 SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyce... 25 8.7 >SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 28.7 bits (61), Expect = 0.53 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -1 Query: 143 PMYTYNF*LSGSSGNRSSVRKMTAIQGISPNLLKPSSL 30 P++TYNF +SG G+ S + K T + + +KPS + Sbjct: 287 PLFTYNFNISGFDGD-SCIEKFTPLDALG---IKPSPI 320 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 27.1 bits (57), Expect = 1.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 250 EECSPTRTETSRASSYTNSLTEGNFYTTALYFSL 351 E SPTR+ SS++ S+ +G+F L F L Sbjct: 472 ETKSPTRSSPRDLSSFSTSVNDGSFLFKNLMFGL 505 >SPBC19F5.01c |puc1|SPBP8B7.32c|cyclin Puc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 359 Score = 26.6 bits (56), Expect = 2.2 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -1 Query: 323 KFPSVKLFVYDEALDVSVLVGEHSSMFLASQSPTLAVRDTDSFNMWPA-VSTTLGWMSDP 147 KFP+ K+ A V +V EH FL + + R D+F +WP + T +M + Sbjct: 257 KFPASKI-----ACSVMNIVNEHVGSFLLTHPSMESYRKDDNF-LWPEDLDTVTSYMENM 310 Query: 146 PPMY 135 Y Sbjct: 311 SKRY 314 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 26.2 bits (55), Expect = 2.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 70 MAVILRTELRFPDDPESQKLYVYIGGG 150 +A IL FP++ E+ +L ++GGG Sbjct: 968 LATILDNASLFPENDETDQLNTFVGGG 994 >SPBC1289.11 |spf38|cwf17|splicing factor Spf38|Schizosaccharomyces pombe|chr 2|||Manual Length = 340 Score = 25.8 bits (54), Expect = 3.8 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +1 Query: 88 TELRFPDDPESQKLYVYIGGGSLIHPSVVLTAGHMLNESVSLTARVGDWDARNIEECSPT 267 T L D QK+ + G +++ VL G L SVS + WD+R+ ++C T Sbjct: 115 THLMSWDAVSGQKIRKHKGHAGVVNALDVLKVGSELLTSVSDDCTMKVWDSRS-KDCIKT 173 Query: 268 RTE 276 E Sbjct: 174 IEE 176 >SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 711 Score = 25.4 bits (53), Expect = 5.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 47 ASSVKYPGWLSFCELSSDSLTTPKVRSC 130 AS +YPG+ S S T VRSC Sbjct: 198 ASHAEYPGFSGLTPFSIHSPTASSVRSC 225 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 25.4 bits (53), Expect = 5.0 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = -1 Query: 239 ASQSPTLAVRDTDSFNMWPAVS--------TTLGWMSDPPPMYTYNF*LSGSS 105 A+Q + +R N WP V TTL W + P ++ L GSS Sbjct: 178 AAQKDRVHLRSNTLINTWPNVGHLFAGKWKTTLPWRVESPELHAVQVHLGGSS 230 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.4 bits (53), Expect = 5.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 351 ESPVDLTPNVGVACLPPPMDSPAAKT 428 E+P P+VGV +PPP +P T Sbjct: 1196 EAPPVPKPSVGVPPVPPPSTAPPVPT 1221 >SPAC4G8.04 |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 772 Score = 25.0 bits (52), Expect = 6.6 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -1 Query: 185 PAVSTTLGWMSDPPPMYTYNF*LSGSSGN---RSSVRKMTAIQGISPNLLKPSS 33 P+VS+T + P + TY+ SS N RSS+ K+ + ++ L SS Sbjct: 286 PSVSSTFVSATSEPEVETYSVSTKNSSSNKNLRSSLSKLLSTSNLNNKPLSLSS 339 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 25.0 bits (52), Expect = 6.6 Identities = 21/50 (42%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = +3 Query: 126 VVRIHRRGIAHPPERGADRGP-----HVERVRVPHR--QGRGLGREEHRG 254 V+R HR A PP RG GP H + PH GRG GR RG Sbjct: 89 VLRGHRAYYAPPPPRGPLFGPRIGGGHHGPLHGPHGGFGGRGGGRMGGRG 138 >SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 268 Score = 25.0 bits (52), Expect = 6.6 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 181 AGHMLNESVSLTARVGDWDARNIEECSPTRTETS 282 AG +L + S T+ WD+ ++ EC PT TET+ Sbjct: 127 AGAVLIKKAS-TSNSSGWDSIHVFECLPT-TETN 158 >SPAC22F3.09c |res2|mcs1, pct1|MBF transcription factor complex subunit Res2|Schizosaccharomyces pombe|chr 1|||Manual Length = 657 Score = 24.6 bits (51), Expect = 8.7 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 101 NRSSVRKMTAIQGISPNLLKPSSLWYAVSRAIP 3 N ++ + GISP ++ PS +A +AIP Sbjct: 423 NSNASHSAFSFSGISPAIISPSCSSHAFVKAIP 455 >SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 414 Score = 24.6 bits (51), Expect = 8.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 157 IHPSVVLTAGHMLNESVSLTARVGDWDARNI 249 IHP+ +++ G + +VS+ ARV D I Sbjct: 290 IHPNAIVSKGAKIGPNVSIGARVRIEDGARI 320 >SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 612 Score = 24.6 bits (51), Expect = 8.7 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 64 PWMAVILRTELRFPDDPESQKL--YVYIGGGSLIH 162 PW + + + R+ DP +QK+ +V +GGG+ +H Sbjct: 214 PWHYMCMFLDTRY--DPSTQKIRGHVALGGGTDMH 246 >SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 818 Score = 24.6 bits (51), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 345 FLESPVDLTPNVGVACLPPPMDSPAA 422 FLE+P+ + PNV + P + S A+ Sbjct: 387 FLEAPLPVQPNVQAETVTPKISSKAS 412 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,099,306 Number of Sequences: 5004 Number of extensions: 42430 Number of successful extensions: 130 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -