BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30196X (509 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03360.1 68418.m00289 DC1 domain-containing protein contains ... 32 0.26 At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein ... 31 0.60 At2g36290.1 68415.m04453 hydrolase, alpha/beta fold family prote... 31 0.60 At5g35570.1 68418.m04232 expressed protein similar to axi 1 [Nic... 29 1.4 At1g29180.1 68414.m03570 DC1 domain-containing protein contains ... 29 1.4 At4g26380.1 68417.m03795 DC1 domain-containing protein contains ... 29 1.8 At3g63100.1 68416.m07087 glycine-rich protein 29 2.4 At5g50380.1 68418.m06240 exocyst subunit EXO70 family protein co... 28 3.2 At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK... 28 3.2 At2g28460.1 68415.m03457 DC1 domain-containing protein contains ... 28 3.2 At2g26910.1 68415.m03228 ABC transporter family protein similar ... 28 4.2 At1g66450.1 68414.m07549 DC1 domain-containing protein contains ... 28 4.2 At2g32880.1 68415.m04031 meprin and TRAF homology domain-contain... 27 5.5 At5g51270.1 68418.m06356 protein kinase family protein contains ... 27 7.3 At4g00260.1 68417.m00033 transcriptional factor B3 family protei... 27 9.7 At2g15900.1 68415.m01822 phox (PX) domain-containing protein wea... 27 9.7 >At5g03360.1 68418.m00289 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1610 Score = 31.9 bits (69), Expect = 0.26 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 207 HGLVQHVARGQHHARVDERSPAD 139 HG++QH + QHH ++DE + D Sbjct: 1407 HGIIQHFSHPQHHLKLDENTSKD 1429 Score = 27.9 bits (59), Expect = 4.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 204 GLVQHVARGQHHARVDERSPAD 139 G++QH + HH R+DE + D Sbjct: 408 GIIQHFSHKHHHLRLDENTDRD 429 >At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein similar to potato PCP1 zinc finger protein, GenBank accession number X82328 contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 402 Score = 30.7 bits (66), Expect = 0.60 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = +3 Query: 306 FNRRKFLYD--GALLFLESPVDLTPNVGVACLPPPMDSPAAKTKCL--ATGWGKDNFGKE 473 F F+++ +LLF SP+ + P++ A L P + + T L AT FG Sbjct: 232 FQGHHFMFNKSSSLLFTSSPLFIEPSLSTAALSTPPTAALSATALLQKATSLSSTTFGGG 291 Query: 474 GRHRGI 491 G+ R I Sbjct: 292 GQTRSI 297 >At2g36290.1 68415.m04453 hydrolase, alpha/beta fold family protein low similarity to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Rhodococcus sp. RHA1] GI:8978311; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 364 Score = 30.7 bits (66), Expect = 0.60 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +3 Query: 144 RGIAHPPER--GADRGPHVERVRVPHRQGRGLGREEHRGVFTHQDRNVKSFIIHEQFNRR 317 + I PP + G+ GP + R+ R GR L +EH GV + K ++H + R Sbjct: 35 KAIQPPPSKLCGSPDGPSITGPRIKLRDGRQLAYKEH-GV-PRDEATHKIIVVHGSDSCR 92 Query: 318 KFLYDGALLFLESPVDLTPNVGV 386 +D A L SP D+ +GV Sbjct: 93 ---HDNAFAALLSP-DIKEGLGV 111 >At5g35570.1 68418.m04232 expressed protein similar to axi 1 [Nicotiana tabacum] GI:559921; contains Pfam profile PF03138: Plant protein family Length = 652 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +1 Query: 130 YVYIGGGSLIHPSVVLTAGHMLNESVSLTARVGDW---DARNIEECSPTRTETSRASSYT 300 Y+Y GG+ + P++V+ A ++ + S+ G W ++ N C + + + T Sbjct: 192 YIYKDGGNDVDPTLVMVASDVVGDQNSVVEFSGVWAKPESGNFSRCIDSSRSRKKLGANT 251 Query: 301 N 303 N Sbjct: 252 N 252 >At1g29180.1 68414.m03570 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 444 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 204 GLVQHVARGQHHARVDERSPAD 139 G++QH + QHH R+DE D Sbjct: 151 GIIQHFSHQQHHLRLDENKDRD 172 >At4g26380.1 68417.m03795 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1016 Score = 29.1 bits (62), Expect = 1.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 204 GLVQHVARGQHHARVDERSPAD 139 G++QH QHH R+DE + D Sbjct: 738 GVIQHFGHPQHHLRLDENTSRD 759 >At3g63100.1 68416.m07087 glycine-rich protein Length = 199 Score = 28.7 bits (61), Expect = 2.4 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +3 Query: 132 RIHRRGIAHPPERGADRGPHVERVRVPHRQGRGLGREEHRG 254 R H R H +RG RG H HR+GRG G RG Sbjct: 107 RRHGRDHRHGRDRGHHRG-HGHHHHRGHRRGRGRGHGHGRG 146 >At5g50380.1 68418.m06240 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 683 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -2 Query: 439 ARHLVLAAGESMGGGKQATPTLGVRSTGDSRKSRAPSYKNF 317 +R L ESMGG +P+ G RS S+ + ++ F Sbjct: 556 SRVLSALRDESMGGSSSGSPSYGQRSNNSSKMALKERFRGF 596 >At5g25110.1 68418.m02975 CBL-interacting protein kinase 25 (CIPK25) identical to CBL-interacting protein kinase 25 [Arabidopsis thaliana] gi|17646697|gb|AAL41008 Length = 488 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 6/80 (7%) Frame = +1 Query: 79 ILRTELRFPD--DPESQ----KLYVYIGGGSLIHPSVVLTAGHMLNESVSLTARVGDWDA 240 I ++E +P PES+ KL V + P+++ T N + + ++ + + Sbjct: 255 IFKSEFEYPPWFSPESKRLISKLLVVDPNKRISIPAIMRTPWFRKNINSPIEFKIDELEI 314 Query: 241 RNIEECSPTRTETSRASSYT 300 +N+E+ +PT T T+ ++ T Sbjct: 315 QNVEDETPTTTATTATTTTT 334 >At2g28460.1 68415.m03457 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 704 Score = 28.3 bits (60), Expect = 3.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 204 GLVQHVARGQHHARVDERSPAD 139 G++QH + QHH ++DE + D Sbjct: 400 GIIQHFSHQQHHMKLDENTGRD 421 >At2g26910.1 68415.m03228 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1420 Score = 27.9 bits (59), Expect = 4.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 265 TRTETSRASSYTNSLTEGNFYTTALYFSL 351 T T R + + N++ +GN Y +LYFS+ Sbjct: 520 TMTVFCRTTMHHNTIDDGNIYLGSLYFSM 548 >At1g66450.1 68414.m07549 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 700 Score = 27.9 bits (59), Expect = 4.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -3 Query: 213 EGHGLVQHVARGQHHARVDERSPAD 139 +G+G++QH + QH+ +DE + D Sbjct: 395 KGNGIIQHFSHQQHYLSLDENTGRD 419 >At2g32880.1 68415.m04031 meprin and TRAF homology domain-containing protein / MATH domain-containing protein low similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 318 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 273 RNVKSFIIHEQFNRRKFLYDGALLFLESPVDLTPNVGVACLPPPM 407 + V FI H Q R + D A+ + E ++ PN V +P M Sbjct: 117 QGVVKFITHTQLKERFLVNDKAVFYAEISEEVIPNFLVTGIPRTM 161 >At5g51270.1 68418.m06356 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 819 Score = 27.1 bits (57), Expect = 7.3 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +2 Query: 5 ESLWRQRTKARKASASSVKYPGWLSFCELSSDSLTTPKVRSCTYTSAGDRSSTRAW 172 ESL + KAR + +++ P FC L D + P + + YT DR + W Sbjct: 729 ESLKKVADKARNSLSAAPSQPPSHFFCPLLKDVMKEPCIAADGYTY--DRRAIEEW 782 >At4g00260.1 68417.m00033 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 528 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +2 Query: 14 WRQRTKARKASASSVKYPGWLSFCE---LSSDSLTTPKV 121 W K +K+S +S+ GW SFC L + S+ T K+ Sbjct: 323 WTLDLKVKKSSGTSLIKRGWRSFCSANGLRAGSIITLKL 361 >At2g15900.1 68415.m01822 phox (PX) domain-containing protein weak similarity to SP|Q9Y5W8 Sorting nexin 13 {Homo sapiens}; contains Pfam profiles PF00787: PX domain, PF02194: PXA domain Length = 1009 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 229 DWDARNIEECSPTRTETSRASSYTNSLTEGNFYTTALY 342 DW AR++E + RTE R + N T+G Y Y Sbjct: 360 DW-ARSLEVATQRRTEVLRPENLENMWTKGRNYQKKEY 396 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,597,346 Number of Sequences: 28952 Number of extensions: 243141 Number of successful extensions: 853 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -