BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30195 (703 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 4.2 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 21 7.4 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 698 CALSIFIIAAFIHHGYFDC 642 C + FIIAA +H F+C Sbjct: 983 CMAAEFIIAALLHPQEFNC 1001 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 698 CALSIFIIAAFIHHGYFDC 642 C + FIIAA +H F+C Sbjct: 983 CMAAEFIIAALLHPQEFNC 1001 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 113 ARMFTEVVKNNPGKSVVLS 169 AR FT+ +KN G +V++ Sbjct: 434 ARFFTDCIKNREGFEMVIA 452 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.4 bits (43), Expect = 7.4 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -1 Query: 151 PWIIFHYFGKHS----GCEVIV--SIFEYIREICDGCHCRDGDSKQTNDCLHVC 8 P + H+F K S C+ + SIF + IC+ C+ + + N C C Sbjct: 36 PAFLPHHFTKRSFFDIQCKGVYDKSIFAKLDSICEDCYMLFREPQLHNLCRSEC 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,728 Number of Sequences: 336 Number of extensions: 3172 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -